BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028677
         (205 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2PIG|A Chain A, Crystal Structure Of Ydck From Salmonella Cholerae At 2.38
           A Resolution. Northeast Structural Genomics Target Scr6
 pdb|2PIG|B Chain B, Crystal Structure Of Ydck From Salmonella Cholerae At 2.38
           A Resolution. Northeast Structural Genomics Target Scr6
          Length = 334

 Score = 29.3 bits (64), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 27/68 (39%), Gaps = 1/68 (1%)

Query: 101 DFLTPPVLKESMMALEKLADVKAVAQGGYPQAERCRLSVGHPEALTSDPDIVAALSITGN 160
           D     VL   ++A+    DVKA   GG+  A+      G       +    A   ITGN
Sbjct: 18  DGEKKSVLLRQVIAVTDFNDVKAGTSGGWVDADNVLSQQGDCWIYDENAXAFAGTEITGN 77

Query: 161 FGF-QPCS 167
               QPC+
Sbjct: 78  ARITQPCT 85


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.138    0.419 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,251,189
Number of Sequences: 62578
Number of extensions: 250932
Number of successful extensions: 548
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 548
Number of HSP's gapped (non-prelim): 2
length of query: 205
length of database: 14,973,337
effective HSP length: 94
effective length of query: 111
effective length of database: 9,091,005
effective search space: 1009101555
effective search space used: 1009101555
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 49 (23.5 bits)