Query         028699
Match_columns 205
No_of_seqs    81 out of 83
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 15:36:41 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028699.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028699hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04852 DUF640:  Protein of un 100.0 1.2E-75 2.6E-80  470.5  11.7  123   32-154    10-132 (132)
  2 PF08821 CGGC:  CGGC domain;  I  91.3    0.35 7.7E-06   37.6   4.3   55   63-127    41-98  (107)
  3 PF02899 Phage_int_SAM_1:  Phag  88.8    0.66 1.4E-05   31.4   3.5   40   44-84     21-60  (84)
  4 cd00798 INT_XerDC XerD and Xer  86.6     2.9 6.2E-05   32.4   6.3   69   44-139    21-91  (284)
  5 cd00799 INT_Cre Cre recombinas  85.5     8.5 0.00019   31.1   8.8   77   44-152     6-82  (287)
  6 TIGR02225 recomb_XerD tyrosine  82.8       5 0.00011   31.4   6.2   70   43-140    19-90  (291)
  7 PRK00283 xerD site-specific ty  82.3       4 8.6E-05   32.6   5.6   67   45-139    30-98  (299)
  8 COG1080 PtsA Phosphoenolpyruva  78.8     2.8 6.1E-05   41.6   4.3   42  110-151   305-368 (574)
  9 TIGR02224 recomb_XerC tyrosine  72.8      15 0.00032   29.0   6.2   69   46-140    22-92  (295)
 10 PF10865 DUF2703:  Domain of un  63.7     2.6 5.6E-05   33.9   0.3   43   73-135     2-44  (120)
 11 TIGR01418 PEP_synth phosphoeno  61.2      13 0.00029   37.3   4.7   42  117-158   547-618 (782)
 12 PRK10529 DNA-binding transcrip  57.9     8.5 0.00018   29.4   2.2   19  115-133   191-209 (225)
 13 cd01185 INT_Tn4399 Tn4399 and   56.4      46 0.00099   27.0   6.3   33   48-80     44-78  (299)
 14 PF02896 PEP-utilizers_C:  PEP-  56.1      15 0.00033   33.0   3.8   40  113-152    58-120 (293)
 15 PF00539 Tat:  Transactivating   53.6     3.2 6.9E-05   31.1  -0.7   17  156-172    45-61  (68)
 16 PRK10816 DNA-binding transcrip  50.9      11 0.00025   28.7   1.9   23  109-131   175-205 (223)
 17 PF05528 Coronavirus_5:  Corona  50.8     2.7 5.8E-05   32.5  -1.5   19  134-152     4-25  (82)
 18 PRK11061 fused phosphoenolpyru  48.0      16 0.00034   36.6   2.9   36  115-150   475-531 (748)
 19 PF13495 Phage_int_SAM_4:  Phag  47.6      21 0.00045   24.3   2.6   53   47-129    24-77  (85)
 20 TIGR01417 PTS_I_fam phosphoeno  47.4      21 0.00044   34.7   3.4   36  115-150   308-365 (565)
 21 PRK00236 xerC site-specific ty  46.9      98  0.0021   24.3   6.6   36   46-82     32-67  (297)
 22 PF00486 Trans_reg_C:  Transcri  45.2      22 0.00047   23.8   2.4   21  114-134    44-64  (77)
 23 COG4974 XerD Site-specific rec  44.4      23  0.0005   32.8   3.1   38   46-85     31-69  (300)
 24 PF13276 HTH_21:  HTH-like doma  42.8      41 0.00089   22.4   3.4   29  117-150     4-32  (60)
 25 PF06252 DUF1018:  Protein of u  41.1 1.5E+02  0.0032   22.7   6.7   88   48-149     2-89  (119)
 26 PF14768 RPA_interact_C:  Repli  40.7      26 0.00056   25.8   2.4   35  104-138    18-56  (82)
 27 cd00801 INT_P4 Bacteriophage P  40.5      49  0.0011   27.1   4.2   26  114-140   135-163 (357)
 28 smart00259 ZnF_A20 A20-like zi  40.2      15 0.00033   22.7   0.9   16   91-106     7-22  (26)
 29 smart00862 Trans_reg_C Transcr  39.7      31 0.00068   22.9   2.5   19  114-132    45-63  (78)
 30 PRK09279 pyruvate phosphate di  39.6      27 0.00059   36.1   3.1   36  123-158   636-685 (879)
 31 PF00140 Sigma70_r1_2:  Sigma-7  36.3      29 0.00063   22.2   1.8   12  142-153     2-13  (37)
 32 PRK06464 phosphoenolpyruvate s  35.3      48   0.001   33.6   4.0   15  135-149   597-612 (795)
 33 cd08793 Death_IRAK4 Death doma  35.0      45 0.00097   26.5   3.0   63   48-132    23-85  (100)
 34 cd04372 RhoGAP_chimaerin RhoGA  34.8      47   0.001   27.2   3.2   36  118-153    45-87  (194)
 35 PF11709 Mit_ribos_Mrp51:  Mito  34.7      58  0.0013   29.4   4.1   67   34-100   144-229 (312)
 36 TIGR01828 pyru_phos_dikin pyru  33.9      23  0.0005   36.3   1.6   25  134-158   652-679 (856)
 37 PRK11177 phosphoenolpyruvate-p  32.3      39 0.00085   33.1   2.8   36  115-150   309-366 (575)
 38 PF01213 CAP_N:  Adenylate cycl  31.9      59  0.0013   29.8   3.7   53  109-167   156-213 (312)
 39 cd04396 RhoGAP_fSAC7_BAG7 RhoG  31.8   2E+02  0.0044   24.3   6.7   37  117-153    60-103 (225)
 40 PF09107 SelB-wing_3:  Elongati  31.3      25 0.00053   24.3   0.9   20   68-87     22-41  (50)
 41 PRK10701 DNA-binding transcrip  31.1      39 0.00084   26.3   2.1   16  115-130   201-216 (240)
 42 smart00243 GAS2 Growth-Arrest-  31.0      34 0.00073   26.1   1.7   14   48-61     55-68  (73)
 43 KOG2675 Adenylate cyclase-asso  30.9      81  0.0018   31.2   4.6   25  135-159   180-204 (480)
 44 cd00383 trans_reg_C Effector d  29.5      47   0.001   22.8   2.1   20  114-133    62-81  (95)
 45 PF08544 GHMP_kinases_C:  GHMP   29.3     7.2 0.00016   26.5  -2.0   72   45-128     6-84  (85)
 46 PF09336 Vps4_C:  Vps4 C termin  29.2      48   0.001   23.5   2.1   31   49-84     32-62  (62)
 47 PRK11235 bifunctional antitoxi  29.0 1.4E+02  0.0031   22.5   4.8   38  118-165    11-48  (80)
 48 PF03801 Ndc80_HEC:  HEC/Ndc80p  28.7 1.1E+02  0.0025   24.9   4.5   46   35-80     28-79  (157)
 49 COG0745 OmpR Response regulato  28.1      46   0.001   28.3   2.2   27  108-134   178-212 (229)
 50 PTZ00398 phosphoenolpyruvate c  27.8 1.1E+02  0.0024   32.3   5.2   43  113-155   264-337 (974)
 51 PF09674 DUF2400:  Protein of u  27.3      55  0.0012   28.9   2.6   52  110-161    24-94  (232)
 52 PRK09468 ompR osmolarity respo  26.9      50  0.0011   25.6   2.1   17  115-131   201-217 (239)
 53 TIGR02249 integrase_gron integ  26.7 1.2E+02  0.0026   25.1   4.3   33   46-82     23-55  (315)
 54 cd04388 RhoGAP_p85 RhoGAP_p85:  26.7      84  0.0018   26.9   3.5   34  120-153    45-82  (200)
 55 PRK05084 xerS site-specific ty  26.7 1.2E+02  0.0026   25.7   4.5   68   46-129    42-119 (357)
 56 PF10520 Kua-UEV1_localn:  Kua-  26.5      31 0.00067   29.4   0.9   24  112-135    17-41  (178)
 57 cd01187 INT_SG4 INT_SG4, DNA b  26.2   3E+02  0.0064   22.5   6.5   59   48-139    25-86  (299)
 58 PF09958 DUF2192:  Uncharacteri  26.2      57  0.0012   29.3   2.5   21  115-135    27-47  (231)
 59 PF07535 zf-DBF:  DBF zinc fing  26.1      34 0.00074   23.8   0.9   12  113-124    37-48  (49)
 60 PF00179 UQ_con:  Ubiquitin-con  25.5 1.6E+02  0.0034   22.5   4.6   45  112-159    90-137 (140)
 61 PRK11173 two-component respons  25.4      55  0.0012   25.5   2.1   19  115-133   200-218 (237)
 62 PF06947 DUF1290:  Protein of u  25.2      62  0.0013   25.5   2.3   17  114-130    16-32  (88)
 63 TIGR02384 RelB_DinJ addiction   24.6   2E+02  0.0044   21.3   4.8   39  118-166    12-50  (83)
 64 PLN02837 threonine-tRNA ligase  24.4      30 0.00066   33.6   0.6   15  110-124   489-503 (614)
 65 cd01355 AcnX Putative Aconitas  24.4      75  0.0016   30.2   3.1   54   70-135    48-108 (389)
 66 PF01663 Phosphodiest:  Type I   24.4      59  0.0013   27.0   2.2   27  109-135   208-234 (365)
 67 KOG1452 Predicted Rho GTPase-a  24.1      40 0.00086   32.6   1.2   30  122-152   233-270 (442)
 68 cd04379 RhoGAP_SYD1 RhoGAP_SYD  24.1      95  0.0021   26.2   3.4   39  114-153    44-89  (207)
 69 PF07700 HNOB:  Heme NO binding  24.0      23  0.0005   28.3  -0.3   36   47-82     65-103 (171)
 70 COG4865 Glutamate mutase epsil  23.7      51  0.0011   32.2   1.9   22  119-140   196-217 (485)
 71 cd00778 ProRS_core_arch_euk Pr  23.6      38 0.00082   29.0   0.9   17  109-125   244-260 (261)
 72 cd08782 Death_DAPK1 Death doma  23.4      43 0.00092   24.9   1.1   28  106-133    47-75  (82)
 73 PF10780 MRP_L53:  39S ribosoma  23.4      35 0.00077   23.7   0.6   25  137-162     2-28  (51)
 74 cd04399 RhoGAP_fRGD2 RhoGAP_fR  23.2      93   0.002   26.2   3.2   35  118-153    51-94  (212)
 75 cd08802 Death_UNC5B Death doma  22.9      50  0.0011   25.3   1.4   17  117-133    60-76  (84)
 76 cd04383 RhoGAP_srGAP RhoGAP_sr  22.6      99  0.0022   25.4   3.2   35  118-153    47-88  (188)
 77 cd04377 RhoGAP_myosin_IX RhoGA  22.5   2E+02  0.0044   23.3   4.9   61   73-153    19-83  (186)
 78 cd04390 RhoGAP_ARHGAP22_24_25   22.1 1.4E+02  0.0031   24.3   4.0   37  117-153    50-90  (199)
 79 PF06480 FtsH_ext:  FtsH Extrac  22.1 1.1E+02  0.0024   21.1   2.9   26  113-138    84-109 (110)
 80 cd04436 DEP_fRgd2 DEP (Disheve  21.9      57  0.0012   25.2   1.5   41   50-90     33-77  (84)
 81 cd08799 Death_UNC5C Death doma  21.9      48   0.001   25.3   1.1   17  117-133    60-76  (84)
 82 cd04384 RhoGAP_CdGAP RhoGAP_Cd  21.9 1.4E+02   0.003   24.7   3.9   38  114-153    43-88  (195)
 83 cd08177 MAR Maleylacetate redu  21.7      53  0.0011   28.9   1.5   93   60-153   102-197 (337)
 84 cd08800 Death_UNC5A Death doma  21.6      48   0.001   25.6   1.0   17  117-133    60-76  (84)
 85 PF00618 RasGEF_N:  RasGEF N-te  21.6      55  0.0012   23.5   1.3   13  113-125     4-16  (104)
 86 PF12067 Sox_C_TAD:  Sox C-term  21.5      50  0.0011   28.7   1.3   16   46-61    140-155 (197)
 87 PF10774 DUF4226:  Domain of un  21.2 1.5E+02  0.0032   23.7   3.7   34  115-149    48-81  (112)
 88 cd04406 RhoGAP_myosin_IXA RhoG  20.7   1E+02  0.0022   25.3   2.9   36  118-153    44-83  (186)
 89 PF02187 GAS2:  Growth-Arrest-S  20.5      19 0.00042   27.1  -1.2   13   49-61     56-68  (73)
 90 PRK13977 myosin-cross-reactive  20.5 1.1E+02  0.0023   30.5   3.4  100   48-165   161-270 (576)
 91 PF12055 DUF3536:  Domain of un  20.3      80  0.0017   29.0   2.3   42  108-154     8-49  (285)

No 1  
>PF04852 DUF640:  Protein of unknown function (DUF640);  InterPro: IPR006936 This conserved region is found in plant proteins including the resistance protein-like protein (O49468 from SWISSPROT).
Probab=100.00  E-value=1.2e-75  Score=470.50  Aligned_cols=123  Identities=84%  Similarity=1.468  Sum_probs=119.5

Q ss_pred             CCCCCCCchhHHhhhhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhh
Q 028699           32 SPSATTPSRYESQKRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQ  111 (205)
Q Consensus        32 ~~~~~~~SrYesQKRrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQ  111 (205)
                      ..+++++||||+|||||||||+|||+||+|||+|++|+++|||+||+|+|||||||||.++|+||||++||+||+|||||
T Consensus        10 ~~~~~~~SrYesQKrrdwntf~qyL~n~rPP~~L~~csg~hVl~FL~~~d~~GkTkVh~~~C~~~g~~~~p~~C~CPlrq   89 (132)
T PF04852_consen   10 RSPQPAPSRYESQKRRDWNTFGQYLRNHRPPLSLSRCSGNHVLEFLRYLDQFGKTKVHGQGCPFFGHPSPPAPCPCPLRQ   89 (132)
T ss_pred             CCCCCCCcccchhhhHHHHHHHHHHHccCCCcchhhcChHHHHHHHHHHhccCCeeecCCCCCCCCCCCCCCCCCCcHHH
Confidence            34556889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hcchhHHHHHHHHHHHHHhCCCCCCCcchhhHHHHHHHHHHHH
Q 028699          112 AWGSLDALIGRLRAAYEEHGGRPEANPFGARAVRIFLREVRDF  154 (205)
Q Consensus       112 AWGSLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~  154 (205)
                      |||||||||||||||||||||+||+|||+++|||+|||||||+
T Consensus        90 AwGSlDalIGrLraafee~Gg~pe~NPf~~~~vr~yLr~vr~~  132 (132)
T PF04852_consen   90 AWGSLDALIGRLRAAFEEHGGHPEANPFAARAVRLYLREVRDS  132 (132)
T ss_pred             HhccHHHHHHHHHHHHHHhCCCCCCCchhhHHHHHHHHHHhcC
Confidence            9999999999999999999999999999999999999999985


No 2  
>PF08821 CGGC:  CGGC domain;  InterPro: IPR014925 Proteins in this entry are a quite highly conserved sequence of CGGC in its central region. The region has many conserved cysteines and histidines suggestive of a zinc binding function. 
Probab=91.30  E-value=0.35  Score=37.64  Aligned_cols=55  Identities=22%  Similarity=0.553  Sum_probs=44.9

Q ss_pred             CCCCCCc---chhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHH
Q 028699           63 LSLPMCS---GAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAY  127 (205)
Q Consensus        63 lsL~~cs---g~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLRAaf  127 (205)
                      +.+.+|.   +..|+..++.+-..|-..||...|.+.+.+.+    .||.      +|.|+-.|+++|
T Consensus        41 vgf~~CgGCpg~~~~~~~~~l~~~~~d~IHlssC~~~~~~~~----~CP~------~~~~~~~I~~~~   98 (107)
T PF08821_consen   41 VGFFTCGGCPGRKLVRRIKKLKKNGADVIHLSSCMVKGNPHG----PCPH------IDEIKKIIEEKF   98 (107)
T ss_pred             EEEeeCCCCChhHHHHHHHHHHHCCCCEEEEcCCEecCCCCC----CCCC------HHHHHHHHHHHh
Confidence            3345555   58899999999999999999999999987553    6665      899999999888


No 3  
>PF02899 Phage_int_SAM_1:  Phage integrase, N-terminal SAM-like domain;  InterPro: IPR004107 Proteins containing this domain cleave DNA substrates by a series of staggered cuts, during which the protein becomes covalently linked to the DNA through a catalytic tyrosine residue at the carboxy end of the alignment [, ].  The phage integrase N-terminal SAM-like domain is almost always found with the signature that defines the phage integrase family (see IPR002104 from INTERPRO).; GO: 0003677 DNA binding, 0015074 DNA integration; PDB: 1Z1G_B 1Z19_A 1Z1B_A 2OXO_A 1P7D_B 3NRW_A 1A0P_A.
Probab=88.80  E-value=0.66  Score=31.37  Aligned_cols=40  Identities=28%  Similarity=0.458  Sum_probs=31.7

Q ss_pred             hhhhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccC
Q 028699           44 QKRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFG   84 (205)
Q Consensus        44 QKRrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfG   84 (205)
                      .-+++++.|.+||.+ ....++..++..||.+|+.++-+.|
T Consensus        21 ~Y~~~l~~f~~~~~~-~~~~~~~~i~~~~v~~f~~~~~~~~   60 (84)
T PF02899_consen   21 SYRRDLRRFIRWLEE-HGIIDWEDITEEDVRDFLEYLAKEG   60 (84)
T ss_dssp             HHHHHHHHHHHHHHH-TTS-CGGG--HHHHHHHHHHHHCTT
T ss_pred             HHHHHHHHHHHhhhh-hhhhhhhhhhhHHHHHHHHHHHccC
Confidence            446789999999999 5667788899999999999998766


No 4  
>cd00798 INT_XerDC XerD and XerC integrases, DNA breaking-rejoining enzymes, N- and C-terminal domains. XerD-like integrases are involved in the site-specific integration and excision of lysogenic bacteriophage genomes, transposition of conjugative transposons, termination of chromosomal replication, and stable plasmid inheritance. They share the same fold in their catalytic domain containing six conserved active site residues and the overall reaction mechanism with the DNA breaking-rejoining enzyme superfamily.  In Escherichia coli, the Xer site-specific recombination system acts to convert dimeric chromosomes, which are formed by homologous recombination to monomers. Two related recombinases, XerC and XerD, bind cooperatively to a recombination site present in the E. coli chromosome. Each recombinase catalyzes the exchange of one pair of DNA strand in a reaction that proceeds through a Holliday junction intermediate. These enzymes can bridge two different and well-separated DNA sequen
Probab=86.58  E-value=2.9  Score=32.40  Aligned_cols=69  Identities=23%  Similarity=0.258  Sum_probs=48.1

Q ss_pred             hhhhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHH
Q 028699           44 QKRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRL  123 (205)
Q Consensus        44 QKRrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRL  123 (205)
                      +-+..|+.|.+|+....... +..-+..||.+|+.++...|                          ....++...++-|
T Consensus        21 ~~~~~~~~~~~~~~~~~~~~-~~~l~~~~i~~~~~~~~~~~--------------------------~~~~t~~~~~~~l   73 (284)
T cd00798          21 AYRRDLERFLEFLEERGILF-PADVTPDDIRRFLAELKDQG--------------------------LSARSIARKLSAL   73 (284)
T ss_pred             HHHHHHHHHHHHHHHcCCCc-hhhCCHHHHHHHHHHhhhcC--------------------------CCHHHHHHHHHHH
Confidence            34567899999998754332 56678899999999887644                          1335777788888


Q ss_pred             HHHHHHhC--CCCCCCcc
Q 028699          124 RAAYEEHG--GRPEANPF  139 (205)
Q Consensus       124 RAafEE~G--g~pE~NPF  139 (205)
                      +++|.-..  +--+.||+
T Consensus        74 ~~~~~~~~~~~~~~~~p~   91 (284)
T cd00798          74 RSFFKFLLREGLILANPA   91 (284)
T ss_pred             HHHHHHHHHcCCccCChh
Confidence            88887322  33456777


No 5  
>cd00799 INT_Cre Cre recombinase, C-terminal catalytic domain.  Cre-like recombinases belong to the superfamily of DNA breaking-rejoining enzymes, which share the same fold in their catalytic domain and the overall reaction mechanism.  The bacteriophage P1 Cre recombinase maintains the circular phage replicon in a monomeric state by catalyzing a site-specific recombination between two loxP sites.  The catalytic core domain of Cre recombinase is linked to a more divergent helical N-terminal domain, which interacts primarily with the DNA major groove proximal to the crossover region.
Probab=85.47  E-value=8.5  Score=31.15  Aligned_cols=77  Identities=22%  Similarity=0.291  Sum_probs=53.1

Q ss_pred             hhhhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHH
Q 028699           44 QKRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRL  123 (205)
Q Consensus        44 QKRrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRL  123 (205)
                      .-..+++.|..|+..+-  +....-+..+|.+|+.||.+.                           .+..++-..++.|
T Consensus         6 ~y~~~l~~f~~~~~~~~--~~~~~~~~~~i~~~~~~l~~~---------------------------~s~~ti~~~~~~l   56 (287)
T cd00799           6 AYLSDWRRFAAWCQAHG--RTPLPASPETVTLYLTDLADS---------------------------LAPSTISRRLSAL   56 (287)
T ss_pred             HHHHHHHHHHHHHHhcC--CCCCCCCHHHHHHHHHHHHhc---------------------------cChHHHHHHHHHH
Confidence            34568889999998752  222234589999999988531                           1457888999999


Q ss_pred             HHHHHHhCCCCCCCcchhhHHHHHHHHHH
Q 028699          124 RAAYEEHGGRPEANPFGARAVRIFLREVR  152 (205)
Q Consensus       124 RAafEE~Gg~pE~NPF~araVRlYLReVR  152 (205)
                      +.+|+..+.   .||+....++.-|+.++
T Consensus        57 ~~~~~~~~~---~~p~~~~~~~~~~~~~~   82 (287)
T cd00799          57 SQLHRRSGL---PSPADSPLVRLVLRGIR   82 (287)
T ss_pred             HHHHHHcCC---CCCccCHHHHHHHHHHH
Confidence            999985433   58877655666665554


No 6  
>TIGR02225 recomb_XerD tyrosine recombinase XerD. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerD, one of two closely related chromosomal proteins along with XerC (TIGR02224). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and with homologs of XerD on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerD, as some apparent XerD examples score below the trusted and noise cutoff scores. XerC and XerD interact with cell division protein FtsK.
Probab=82.78  E-value=5  Score=31.42  Aligned_cols=70  Identities=24%  Similarity=0.402  Sum_probs=47.5

Q ss_pred             HhhhhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHH
Q 028699           43 SQKRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGR  122 (205)
Q Consensus        43 sQKRrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGR  122 (205)
                      .+-+..++.|..|+....  ..+..-+..||.+|+.++.+.|                          .+.-++...++.
T Consensus        19 ~~~~~~~~~~~~~~~~~~--~~~~~it~~~i~~~~~~~~~~~--------------------------~~~~t~~~~~~~   70 (291)
T TIGR02225        19 EAYRRDLEKFLEFLEERG--IDLEEVDRGDIVDFLAELKEAG--------------------------LSARSIARALSA   70 (291)
T ss_pred             HHHHHHHHHHHHHHHhcC--CChHHCCHHHHHHHHHHhhcCC--------------------------CCHhHHHHHHHH
Confidence            445567788999998542  2455567899999999887644                          122467888999


Q ss_pred             HHHHHHHh--CCCCCCCcch
Q 028699          123 LRAAYEEH--GGRPEANPFG  140 (205)
Q Consensus       123 LRAafEE~--Gg~pE~NPF~  140 (205)
                      |+++|+-.  -+--+.|||.
T Consensus        71 l~~~~~~a~~~~~~~~np~~   90 (291)
T TIGR02225        71 LRSFYRFLLREGIREDDPSA   90 (291)
T ss_pred             HHHHHHHHHhcccccCCchh
Confidence            99988732  2334568863


No 7  
>PRK00283 xerD site-specific tyrosine recombinase XerD; Reviewed
Probab=82.28  E-value=4  Score=32.58  Aligned_cols=67  Identities=25%  Similarity=0.270  Sum_probs=47.1

Q ss_pred             hhhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHH
Q 028699           45 KRRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLR  124 (205)
Q Consensus        45 KRrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLR  124 (205)
                      -+.+|+.|..||..+.-  .+...+..||.+|+.++.+.|                          .+-.++...+..|+
T Consensus        30 ~~~~~~~~~~~~~~~~~--~~~~l~~~~i~~~~~~~~~~~--------------------------~~~~t~~~~~~~l~   81 (299)
T PRK00283         30 YRRDLELFAEWLAARGL--SLAEATRDDLQAFLAELAEGG--------------------------YKATSSARRLSALR   81 (299)
T ss_pred             HHHHHHHHHHHHHhcCC--ChHHCCHHHHHHHHHHHHhCC--------------------------CCHHHHHHHHHHHH
Confidence            35688899999986532  566778999999999885432                          23457778888888


Q ss_pred             HHHHHhC--CCCCCCcc
Q 028699          125 AAYEEHG--GRPEANPF  139 (205)
Q Consensus       125 AafEE~G--g~pE~NPF  139 (205)
                      ++|+-..  +--..|||
T Consensus        82 ~~~~~a~~~~~i~~np~   98 (299)
T PRK00283         82 RFFQFLLREGLREDDPS   98 (299)
T ss_pred             HHHHHHHHcCCcccCch
Confidence            8887331  23446776


No 8  
>COG1080 PtsA Phosphoenolpyruvate-protein kinase (PTS system EI component in bacteria) [Carbohydrate transport and metabolism]
Probab=78.76  E-value=2.8  Score=41.58  Aligned_cols=42  Identities=38%  Similarity=0.631  Sum_probs=33.5

Q ss_pred             hhhcchhHHHHHHHHHHHHHhCCCC---------------------CCCcc-hhhHHHHHHHHH
Q 028699          110 RQAWGSLDALIGRLRAAYEEHGGRP---------------------EANPF-GARAVRIFLREV  151 (205)
Q Consensus       110 RQAWGSLDALIGRLRAafEE~Gg~p---------------------E~NPF-~araVRlYLReV  151 (205)
                      |..|=+.|..----++..|.+||+|                     |.||| |-|+||+||..-
T Consensus       305 r~~~P~EeEQ~~aY~~vlea~~g~pviiRTlDiGGDK~lpyl~lp~E~NPfLG~RaIRl~l~~~  368 (574)
T COG1080         305 RDALPDEEEQFEAYKAVLEAMGGKPVIIRTLDIGGDKPLPYLNLPKEENPFLGYRAIRLSLERP  368 (574)
T ss_pred             CCCCCChHHHHHHHHHHHHHcCCCceEEEecccCCCCcCCCCCCccccCchhhhHHHHHhhccH
Confidence            3455567777777888889998883                     79999 899999999643


No 9  
>TIGR02224 recomb_XerC tyrosine recombinase XerC. The phage integrase family describes a number of recombinases with tyrosine active sites that transiently bind covalently to DNA. Many are associated with mobile DNA elements, including phage, transposons, and phase variation loci. This model represents XerC, one of two closely related chromosomal proteins along with XerD (TIGR02225). XerC and XerD are site-specific recombinases which help resolve chromosome dimers to monomers for cell division after DNA replication. In species with a large chromosome and homologs of XerC on other replicons, the chomosomal copy was preferred for building this model. This model does not detect all XerC, as some apparent XerC examples score in the gray zone between trusted (450) and noise (410) cutoffs, along with some XerD examples. XerC and XerD interact with cell division protein FtsK.
Probab=72.77  E-value=15  Score=29.00  Aligned_cols=69  Identities=30%  Similarity=0.363  Sum_probs=46.6

Q ss_pred             hhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHH
Q 028699           46 RRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRA  125 (205)
Q Consensus        46 RrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLRA  125 (205)
                      +.+++.|.+||......+.+..-+..||.+|+.++.+.|.                          +..++...++.|++
T Consensus        22 ~~~~~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~~~~--------------------------~~~T~~~~~~~l~~   75 (295)
T TIGR02224        22 RRDLKAFLEFLEEEGGLASLAEVTAADLRSFLAELHARGL--------------------------SRRSLARKLSALRS   75 (295)
T ss_pred             HHHHHHHHHHHHhcCCCCccccCcHHHHHHHHHHhcccCC--------------------------CHHHHHHHHHHHHH
Confidence            3456678888887665677888889999999998766321                          22456677777887


Q ss_pred             HHHHhC--CCCCCCcch
Q 028699          126 AYEEHG--GRPEANPFG  140 (205)
Q Consensus       126 afEE~G--g~pE~NPF~  140 (205)
                      +|.-..  +.-+.|||.
T Consensus        76 ~~~~a~~~~~~~~np~~   92 (295)
T TIGR02224        76 FYRFLVRRGLIKANPAA   92 (295)
T ss_pred             HHHHHHHcCccccChHh
Confidence            776421  223467763


No 10 
>PF10865 DUF2703:  Domain of unknown function (DUF2703);  InterPro: IPR021219  This family of protein has no known function. 
Probab=63.72  E-value=2.6  Score=33.87  Aligned_cols=43  Identities=28%  Similarity=0.340  Sum_probs=32.9

Q ss_pred             HhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHHHHhCCCCC
Q 028699           73 VLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEEHGGRPE  135 (205)
Q Consensus        73 VleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLRAafEE~Gg~pE  135 (205)
                      +|+|+ |||..|+|      |...+             ..+.+|+..+-+|+.+|+..|..++
T Consensus         2 ~I~w~-~l~~~g~t------C~RC~-------------~Tg~~L~~av~~l~~~L~~~Giev~   44 (120)
T PF10865_consen    2 VIEWQ-HLDLDGKT------CERCG-------------DTGETLREAVKELAPVLAPLGIEVR   44 (120)
T ss_pred             eEEEE-EeecCCCc------CCchh-------------hHHHHHHHHHHHHHHHHHhCCcEEE
Confidence            46786 56655776      54433             5678999999999999999998754


No 11 
>TIGR01418 PEP_synth phosphoenolpyruvate synthase. Also called pyruvate,water dikinase and PEP synthase. The member from Methanococcus jannaschii contains a large intein. This enzyme generates phosphoenolpyruvate (PEP) from pyruvate, hydrolyzing ATP to AMP and releasing inorganic phosphate in the process. The enzyme shows extensive homology to other enzymes that use PEP as substrate or product. This enzyme may provide PEP for gluconeogenesis, for PTS-type carbohydrate transport systems, or for other processes.
Probab=61.24  E-value=13  Score=37.27  Aligned_cols=42  Identities=21%  Similarity=0.311  Sum_probs=30.6

Q ss_pred             HHHHHHHHHHHHHhCCC-------------------------CCCCcc-hhhHHHHHH----HHHHHHHHhh
Q 028699          117 DALIGRLRAAYEEHGGR-------------------------PEANPF-GARAVRIFL----REVRDFQAKA  158 (205)
Q Consensus       117 DALIGRLRAafEE~Gg~-------------------------pE~NPF-~araVRlYL----ReVRd~QAkA  158 (205)
                      |.+.-.+|.+++.++++                         .|.||| |.|.||+||    .++=+.|.+|
T Consensus       547 ~~~~~~y~~i~~~~~~~pV~iRtlD~~~dk~~~~~ggdk~~~~E~NP~LG~RGir~~l~~~~~~lf~~qlra  618 (782)
T TIGR01418       547 DKLAEGIAKVAAAFYPKPVIVRTSDFKSNEYRNLIGGEEYEPDEENPMLGWRGASRYYSESYEEAFRLECRA  618 (782)
T ss_pred             HHHHHHHHHHHHHcCCCeEEEEcCCCCccchhhhhCCCccCCCCCCcccccchhhhhcccccHHHHHHHHHH
Confidence            55566778888876544                         378999 899999999    4466666554


No 12 
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional
Probab=57.88  E-value=8.5  Score=29.36  Aligned_cols=19  Identities=32%  Similarity=0.494  Sum_probs=14.5

Q ss_pred             hhHHHHHHHHHHHHHhCCC
Q 028699          115 SLDALIGRLRAAYEEHGGR  133 (205)
Q Consensus       115 SLDALIGRLRAafEE~Gg~  133 (205)
                      +||.+|.|||.-+++.+..
T Consensus       191 ~~~~~i~rlR~kl~~~~~~  209 (225)
T PRK10529        191 YLRIYMGHLRQKLEQDPAR  209 (225)
T ss_pred             CHHHHHHHHHHHhccCCCC
Confidence            5899999999998765433


No 13 
>cd01185 INT_Tn4399 Tn4399 and related integrases, DNA breaking-rejoining enzymes, integrase/recombinases, N- and C-terminal domains. This CD includes various bacterial integrases, including cLV25, a Bacteroides fragilis chromosomal transfer factor integrase similar to the Bacteroides mobilizable transposon, Tn4399, integrase.
Probab=56.39  E-value=46  Score=27.04  Aligned_cols=33  Identities=15%  Similarity=0.310  Sum_probs=26.1

Q ss_pred             hHHHHHHHHHhcCC--CCCCCCCcchhHhHHHhhh
Q 028699           48 DWNTFCQYLRNHRP--PLSLPMCSGAHVLEFLRYL   80 (205)
Q Consensus        48 dWntf~qyL~n~rP--PlsL~~csg~hVleFLryl   80 (205)
                      .++.|..||....+  .+.|..-+..||.+|+.|+
T Consensus        44 ~~~~~~~~~~~~~~~~~~~l~~i~~~~i~~~~~~l   78 (299)
T cd01185          44 HLKNLREFIECTYKEIDIALLELTREFILEFKLFL   78 (299)
T ss_pred             HHHHHHHHHHHhcCccCCCHHHccHHHHHHHHHHH
Confidence            46668888876553  5678888899999999988


No 14 
>PF02896 PEP-utilizers_C:  PEP-utilising enzyme, TIM barrel domain;  InterPro: IPR000121 A number of enzymes that catalyze the transfer of a phosphoryl group from phosphoenolpyruvate (PEP) via a phospho-histidine intermediate have been shown to be structurally related [, , , ]. All these enzymes share the same catalytic mechanism: they bind PEP and transfer the phosphoryl group from it to a histidine residue. The sequence around that residue is highly conserved. This domain is often found associated with the pyruvate phosphate dikinase, PEP/pyruvate-binding domain (IPR002192 from INTERPRO) at its N terminus and the PEP-utilizing enzyme mobile domain.; GO: 0016772 transferase activity, transferring phosphorus-containing groups, 0016310 phosphorylation; PDB: 2HRO_A 2OLS_A 2DIK_A 2R82_A 1JDE_A 1DIK_A 1GGO_A 1KBL_A 1KC7_A 2BG5_B ....
Probab=56.13  E-value=15  Score=33.00  Aligned_cols=40  Identities=30%  Similarity=0.311  Sum_probs=31.6

Q ss_pred             cchhHHHHHHHHHHHHHhCCC----------------------CCCCcc-hhhHHHHHHHHHH
Q 028699          113 WGSLDALIGRLRAAYEEHGGR----------------------PEANPF-GARAVRIFLREVR  152 (205)
Q Consensus       113 WGSLDALIGRLRAafEE~Gg~----------------------pE~NPF-~araVRlYLReVR  152 (205)
                      +=+.+.+...++.+.+.++++                      .|.||| |-|+||+||..-.
T Consensus        58 ~p~e~eq~~~y~~i~~~~~~~pV~iRtlD~g~dK~l~~~~~~~~E~NP~LG~RGiR~~l~~p~  120 (293)
T PF02896_consen   58 PPSEEEQYEIYRKIAEAMGGKPVTIRTLDIGGDKPLPYLSREPKEENPALGLRGIRRSLAHPE  120 (293)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTSEEEEE---SBCCCGSCSSHHCH--SSGGGSSBTHHHHHHSHH
T ss_pred             CchHHHHHHHHHHHHHHhccCcEEEEecCCCCCccCCcccccccccccccccccccccccchh
Confidence            446788899999999988876                      569998 8899999997633


No 15 
>PF00539 Tat:  Transactivating regulatory protein (Tat);  InterPro: IPR001831 Like other lentiviruses, Human immunodeficiency virus 1 (HIV-1) encodes a trans-activating regulatory protein (Tat), which is essential for efficient transcription of the viral genome [, ]. Tat acts by binding to an RNA stem-loop structure, the trans-activating response element (TAR), found at the 5' ends of nascent HIV-1 transcripts. In binding to TAR, Tat alters the properties of the transcription complex, recruits a positive transcription elongation complex (P-TEFb) and hence increases the production of full-length viral RNA []. Tat protein also associates with RNA polymerase II complexes during early transcription elongation after the promoter clearance and before the synthesis of full-length TAR RNA transcript. This interaction of Tat with RNA polymerase II elongation complexes is P-TEFb-independent. There are two Tat binding sites on each transcription elongation complex; one is located on TAR RNA and the other one on RNA polymerase II near the exit site for nascent mRNA transcripts which suggests that two Tat molecules are involved in performing various functions during a single round of HIV-1 mRNA synthesis [].  The minimum Tat sequence that can mediate specific TAR binding in vitro has been mapped to a basic domain of 10 amino acids, comprising mostly Arg and Lys residues. Regulatory activity, however, also requires the 47 N-terminal residues, which interact with components of the transcription complex and function as a transcriptional activation domain [, , ].; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0042025 host cell nucleus; PDB: 2W2H_D 1ZBN_B 1TVS_A 1TVT_A 3O6L_C 3O6M_C 3MI9_C 3MIA_C 1JFW_A 1TBC_A ....
Probab=53.64  E-value=3.2  Score=31.11  Aligned_cols=17  Identities=41%  Similarity=0.802  Sum_probs=12.3

Q ss_pred             HhhhCcchhhhhcCCCc
Q 028699          156 AKARGVSYDKKRKRPKQ  172 (205)
Q Consensus       156 AkARgi~y~kk~~~~~~  172 (205)
                      .|+-||.|.+|||||..
T Consensus        45 ~KgLGI~Y~r~rrRrr~   61 (68)
T PF00539_consen   45 QKGLGISYGRKRRRRRT   61 (68)
T ss_dssp             CTSSSTSSSSSSCSCCC
T ss_pred             eCCCcccccccccCcCC
Confidence            47889999987655443


No 16 
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional
Probab=50.89  E-value=11  Score=28.71  Aligned_cols=23  Identities=30%  Similarity=0.546  Sum_probs=17.1

Q ss_pred             hhhhcc--------hhHHHHHHHHHHHHHhC
Q 028699          109 LRQAWG--------SLDALIGRLRAAYEEHG  131 (205)
Q Consensus       109 lRQAWG--------SLDALIGRLRAafEE~G  131 (205)
                      +++.||        +||.+|.|||.-+++.+
T Consensus       175 ~~~~w~~~~~~~~~~v~~~i~rLR~kl~~~~  205 (223)
T PRK10816        175 MLQLYPDAELRESHTIDVLMGRLRKKIQAQY  205 (223)
T ss_pred             HHHhcCCCCCCCcCCHHHHHHHHHHHhccCC
Confidence            456676        68888999988887643


No 17 
>PF05528 Coronavirus_5:  Coronavirus gene 5 protein;  InterPro: IPR008458 Infectious bronchitis virus, a member of Coronaviridae family, has a single-stranded positive-sense RNA genome, which is 27 kb in length. Gene 5 contains two (5a and 5b) open reading frames. The function of the 5a and 5b proteins is unknown [].
Probab=50.85  E-value=2.7  Score=32.55  Aligned_cols=19  Identities=53%  Similarity=0.747  Sum_probs=15.0

Q ss_pred             CCCCcc---hhhHHHHHHHHHH
Q 028699          134 PEANPF---GARAVRIFLREVR  152 (205)
Q Consensus       134 pE~NPF---~araVRlYLReVR  152 (205)
                      ..+|||   .||-+|+||||=-
T Consensus         4 ~k~NPfr~aiARKaRiyLr~Gl   25 (82)
T PF05528_consen    4 SKDNPFRGAIARKARIYLREGL   25 (82)
T ss_pred             cccCchhhhhhhheeeeeecCC
Confidence            348999   5788999999743


No 18 
>PRK11061 fused phosphoenolpyruvate-protein phosphotransferase PtsP/GAF domain; Provisional
Probab=47.98  E-value=16  Score=36.56  Aligned_cols=36  Identities=25%  Similarity=0.422  Sum_probs=29.8

Q ss_pred             hhHHHHHHHHHHHHHhCCC--------------------CCCCcc-hhhHHHHHHHH
Q 028699          115 SLDALIGRLRAAYEEHGGR--------------------PEANPF-GARAVRIFLRE  150 (205)
Q Consensus       115 SLDALIGRLRAafEE~Gg~--------------------pE~NPF-~araVRlYLRe  150 (205)
                      +-|......|.+.+.++++                    +|.||| |.|+||+||+.
T Consensus       475 ~e~eQ~~~y~~~~~~~~~~pv~iRtlDiGgDK~~~~~~~~E~NP~lG~RgiR~~l~~  531 (748)
T PRK11061        475 SEEEQVAQYQGMLQMFPDKPVTLRTLDIGADKQLPYMPISEENPCLGWRGIRITLDQ  531 (748)
T ss_pred             CHHHHHHHHHHHHHHcCCCeEEEECCCCCcCCCCCCCCCCCCCcccccchhhccccC
Confidence            4678888889999888765                    589999 78999999853


No 19 
>PF13495 Phage_int_SAM_4:  Phage integrase, N-terminal SAM-like domain; PDB: 2A3V_A.
Probab=47.59  E-value=21  Score=24.29  Aligned_cols=53  Identities=17%  Similarity=0.343  Sum_probs=31.9

Q ss_pred             hhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhc-ccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHH
Q 028699           47 RDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLD-QFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRA  125 (205)
Q Consensus        47 rdWntf~qyL~n~rPPlsL~~csg~hVleFLrylD-qfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLRA  125 (205)
                      ...+.|.+|+.+.    .+...+..||.+||.||- .-|                          .+..++...+.-||.
T Consensus        24 ~~l~~f~~~~~~~----~~~~it~~~i~~y~~~l~~~~~--------------------------~s~~T~~~~~~~l~~   73 (85)
T PF13495_consen   24 YHLKRFLRFLGNK----PPDEITPEDIEQYLNYLQNERG--------------------------LSPSTINQYLSALRS   73 (85)
T ss_dssp             HHHHHHHTTSSS------GGG--HHHHHHHHHHHHTTT-----------------------------HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHcccC----ccchhHHHHHHHHHHHHHHhcC--------------------------CCHHHHHHHHHHHHH
Confidence            3445566666522    566678999999999887 322                          345566777777777


Q ss_pred             HHHH
Q 028699          126 AYEE  129 (205)
Q Consensus       126 afEE  129 (205)
                      .|+-
T Consensus        74 ff~~   77 (85)
T PF13495_consen   74 FFRW   77 (85)
T ss_dssp             HHHC
T ss_pred             HHHH
Confidence            7663


No 20 
>TIGR01417 PTS_I_fam phosphoenolpyruvate-protein phosphotransferase. This model recognizes a distinct clade of phophoenolpyruvate (PEP)-dependent enzymes. Most members are known or deduced to function as the phosphoenolpyruvate-protein phosphotransferase (or enzyme I) of PTS sugar transport systems. However, some species with both a member of this family and a homolog of the phosphocarrier protein HPr lack a IIC component able to serve as a permease. An HPr homolog designated NPr has been implicated in the regulation of nitrogen assimilation, which demonstrates that not all phosphotransferase system components are associated directly with PTS transport.
Probab=47.37  E-value=21  Score=34.68  Aligned_cols=36  Identities=28%  Similarity=0.480  Sum_probs=29.1

Q ss_pred             hhHHHHHHHHHHHHHhCCC---------------------CCCCcc-hhhHHHHHHHH
Q 028699          115 SLDALIGRLRAAYEEHGGR---------------------PEANPF-GARAVRIFLRE  150 (205)
Q Consensus       115 SLDALIGRLRAafEE~Gg~---------------------pE~NPF-~araVRlYLRe  150 (205)
                      +.|...-..|.+.+.++++                     -|.||| |-|+||+||..
T Consensus       308 ~e~eq~~~y~~i~~~~~~~pv~iRtlDig~DK~~~~~~~~~E~NP~LG~RgiR~~l~~  365 (565)
T TIGR01417       308 TEEEQFAAYKTVLEAMESDAVIVRTLDIGGDKELPYLNFPKEENPFLGYRAIRLALER  365 (565)
T ss_pred             CHHHHHHHHHHHHHHhCCCceEEECCCCCCcccccccCCCCCCCccccchhhhhcccC
Confidence            4577777788888888766                     379998 89999999974


No 21 
>PRK00236 xerC site-specific tyrosine recombinase XerC; Reviewed
Probab=46.85  E-value=98  Score=24.32  Aligned_cols=36  Identities=31%  Similarity=0.399  Sum_probs=27.1

Q ss_pred             hhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcc
Q 028699           46 RRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQ   82 (205)
Q Consensus        46 RrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDq   82 (205)
                      +.+|+.|..|+..... ..+..-...||.+||.++-+
T Consensus        32 ~~~~~~~~~~~~~~~~-~~~~~i~~~~i~~~~~~~~~   67 (297)
T PRK00236         32 RRDLRAFLAFLEEHGI-SSLQDLDAADLRSFLARRRR   67 (297)
T ss_pred             HHHHHHHHHHHHHcCC-CchhhCCHHHHHHHHHHHHh
Confidence            4577888888887543 55667788999999987754


No 22 
>PF00486 Trans_reg_C:  Transcriptional regulatory protein, C terminal;  InterPro: IPR001867 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions []. Some bacteria can contain up to as many as 200 two-component systems that need tight regulation to prevent unwanted cross-talk []. These pathways have been adapted to response to a wide variety of stimuli, including nutrients, cellular redox state, changes in osmolarity, quorum signals, antibiotics, and more []. Two-component systems are comprised of a sensor histidine kinase (HK) and its cognate response regulator (RR) []. The HK catalyses its own auto-phosphorylation followed by the transfer of the phosphoryl group to the receiver domain on RR; phosphorylation of the RR usually activates an attached output domain, which can then effect changes in cellular physiology, often by regulating gene expression. Some HK are bifunctional, catalysing both the phosphorylation and dephosphorylation of their cognate RR. The input stimuli can regulate either the kinase or phosphatase activity of the bifunctional HK. A variant of the two-component system is the phospho-relay system. Here a hybrid HK auto-phosphorylates and then transfers the phosphoryl group to an internal receiver domain, rather than to a separate RR protein. The phosphoryl group is then shuttled to histidine phosphotransferase (HPT) and subsequently to a terminal RR, which can evoke the desired response [, ]. This entry represents a domain that is almost always found associated with the response regulator receiver domain (see IPR001789 from INTERPRO). It may play a role in DNA binding [].; GO: 0000156 two-component response regulator activity, 0003677 DNA binding, 0000160 two-component signal transduction system (phosphorelay), 0006355 regulation of transcription, DNA-dependent; PDB: 2K4J_A 2JPB_A 1ODD_A 1OPC_A 1KGS_A 2PMU_E 2JZY_A 1GXP_B 1QQI_A 2Z33_A ....
Probab=45.24  E-value=22  Score=23.78  Aligned_cols=21  Identities=52%  Similarity=0.833  Sum_probs=18.1

Q ss_pred             chhHHHHHHHHHHHHHhCCCC
Q 028699          114 GSLDALIGRLRAAYEEHGGRP  134 (205)
Q Consensus       114 GSLDALIGRLRAafEE~Gg~p  134 (205)
                      -+||.+|-|||..++..|+.+
T Consensus        44 ~~l~~~I~rLR~kL~~~~~~~   64 (77)
T PF00486_consen   44 NSLDVHISRLRKKLEDAGGDP   64 (77)
T ss_dssp             HHHHHHHHHHHHHHHSSTTSS
T ss_pred             hhHHHHHHHHHHHHhhcCCCC
Confidence            489999999999999987554


No 23 
>COG4974 XerD Site-specific recombinase XerD [DNA replication, recombination, and repair]
Probab=44.41  E-value=23  Score=32.79  Aligned_cols=38  Identities=29%  Similarity=0.496  Sum_probs=34.0

Q ss_pred             hhhHHHHHHHHHhcCCCC-CCCCCcchhHhHHHhhhcccCc
Q 028699           46 RRDWNTFCQYLRNHRPPL-SLPMCSGAHVLEFLRYLDQFGK   85 (205)
Q Consensus        46 RrdWntf~qyL~n~rPPl-sL~~csg~hVleFLrylDqfGK   85 (205)
                      |||-+.|.+||..+-  + +|...+-.||.+||.++-.+|.
T Consensus        31 rrDL~~f~~~L~~~~--~~~l~~~~~~di~~yl~~l~~~g~   69 (300)
T COG4974          31 RRDLEDFREWLEERG--ITDLADATEADIREYLTELAEQGL   69 (300)
T ss_pred             HHHHHHHHHHHHhcC--CCChhhcCHHHHHHHHHHHHhCCc
Confidence            689999999999876  5 6888899999999999999995


No 24 
>PF13276 HTH_21:  HTH-like domain
Probab=42.76  E-value=41  Score=22.44  Aligned_cols=29  Identities=24%  Similarity=0.403  Sum_probs=25.0

Q ss_pred             HHHHHHHHHHHHHhCCCCCCCcchhhHHHHHHHH
Q 028699          117 DALIGRLRAAYEEHGGRPEANPFGARAVRIFLRE  150 (205)
Q Consensus       117 DALIGRLRAafEE~Gg~pE~NPF~araVRlYLRe  150 (205)
                      |+|+-.++++|+++++     =||.+-|..+|+.
T Consensus         4 ~~l~~~I~~i~~~~~~-----~yG~rri~~~L~~   32 (60)
T PF13276_consen    4 EALRELIKEIFKESKP-----TYGYRRIWAELRR   32 (60)
T ss_pred             HHHHHHHHHHHHHcCC-----CeehhHHHHHHhc
Confidence            6789999999999977     3788888888876


No 25 
>PF06252 DUF1018:  Protein of unknown function (DUF1018);  InterPro: IPR009363 This family consists of several bacterial and phage proteins, related to Gp16 of phage Mu, of unknown function.
Probab=41.11  E-value=1.5e+02  Score=22.68  Aligned_cols=88  Identities=17%  Similarity=0.152  Sum_probs=57.5

Q ss_pred             hHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHH
Q 028699           48 DWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAY  127 (205)
Q Consensus        48 dWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLRAaf  127 (205)
                      |..++..+|.++..=-|...++-....++|.++.+.|-. +....=.+-+.|.  .           ...+.+.+|+|..
T Consensus         2 ddd~YR~~L~~~~Gk~S~k~lt~~el~~vl~~l~~~G~k-~~~~~~~~~~~~~--~-----------~~~~q~~KI~aLw   67 (119)
T PF06252_consen    2 DDDTYRALLQRVTGKSSSKDLTEAELEKVLDELKRLGFK-PPKPARRPGRRPG--M-----------ATSAQLRKIRALW   67 (119)
T ss_pred             CHHHHHHHHHHHhChhhHHHCCHHHHHHHHHHHHHccCc-CccccccCCCCCC--C-----------cchHHHHHHHHHH
Confidence            456788888888887788888999988999888888853 2111111111111  1           1788999999999


Q ss_pred             HHhCCCCCCCcchhhHHHHHHH
Q 028699          128 EEHGGRPEANPFGARAVRIFLR  149 (205)
Q Consensus       128 EE~Gg~pE~NPF~araVRlYLR  149 (205)
                      .++|....-+--...++.-|++
T Consensus        68 ~~~~~~~~v~~~s~~aL~~fvk   89 (119)
T PF06252_consen   68 KQLGKPGAVRDPSEAALDAFVK   89 (119)
T ss_pred             HHhhccCCccchHHHHHHHHHH
Confidence            9999776522223344444443


No 26 
>PF14768 RPA_interact_C:  Replication protein A interacting C-terminal
Probab=40.66  E-value=26  Score=25.79  Aligned_cols=35  Identities=34%  Similarity=0.551  Sum_probs=30.2

Q ss_pred             CCCCchhhhcc----hhHHHHHHHHHHHHHhCCCCCCCc
Q 028699          104 PCPCPLRQAWG----SLDALIGRLRAAYEEHGGRPEANP  138 (205)
Q Consensus       104 pC~CPlRQAWG----SLDALIGRLRAafEE~Gg~pE~NP  138 (205)
                      -|+|-||..-+    ++|.|=-+|..+++||..+...+|
T Consensus        18 ~C~Cgl~l~~~~~~~tl~~l~~~L~~~~~~H~~~C~~~p   56 (82)
T PF14768_consen   18 SCSCGLRLNTQQDELTLEELRQLLEEAVTEHSDRCSSTP   56 (82)
T ss_pred             ECCCccEEecCCCCCCHHHHHHHHHHHHHHHHHhCCCCC
Confidence            47777988888    999999999999999987776666


No 27 
>cd00801 INT_P4 Bacteriophage P4 integrase. P4-like integrases are found in temperate bacteriophages, integrative plasmids, pathogenicity and symbiosis islands, and other mobile genetic elements.  They share the same fold in their catalytic domain and the overall reaction mechanism with the superfamily of DNA breaking-rejoining enzymes. The P4 integrase mediates integrative and excisive site-specific recombination between two sites, called attachment sites, located on the phage genome and the bacterial chromosome. The phage attachment site is often found adjacent to the integrase gene, while the host attachment sites are typically situated near tRNA genes.
Probab=40.51  E-value=49  Score=27.14  Aligned_cols=26  Identities=27%  Similarity=0.349  Sum_probs=19.9

Q ss_pred             chhHHHHHHHHHHHHH---hCCCCCCCcch
Q 028699          114 GSLDALIGRLRAAYEE---HGGRPEANPFG  140 (205)
Q Consensus       114 GSLDALIGRLRAafEE---~Gg~pE~NPF~  140 (205)
                      .++...++.|+++|+-   +|.- +.|||.
T Consensus       135 ~t~~~~~~~l~~~~~~a~~~g~i-~~nP~~  163 (357)
T cd00801         135 ETARRVRQRLKQVFRYAIARGLI-EANPAA  163 (357)
T ss_pred             HHHHHHHHHHHHHHHHHHHcCCc-ccCchH
Confidence            4788999999999984   4443 489985


No 28 
>smart00259 ZnF_A20 A20-like zinc fingers. A20- (an inhibitor of cell death)-like zinc fingers. The zinc finger mediates self-association in A20. These fingers also mediate IL-1-induced NF-kappaB activation.
Probab=40.23  E-value=15  Score=22.66  Aligned_cols=16  Identities=38%  Similarity=0.930  Sum_probs=13.5

Q ss_pred             CCCCCCCCCCCCCCCC
Q 028699           91 QNCPFFGLPNPPAPCP  106 (205)
Q Consensus        91 ~~C~ffG~p~ppapC~  106 (205)
                      .+|.|||.+..-..|.
T Consensus         7 ~~CgF~G~~~t~~~Cs   22 (26)
T smart00259        7 PGCGFFGNPATEGLCS   22 (26)
T ss_pred             CCCCCcCChhhcccCH
Confidence            6999999998777774


No 29 
>smart00862 Trans_reg_C Transcriptional regulatory protein, C terminal. This domain is almost always found associated with the response regulator receiver domain. It may play a role in DNA binding.
Probab=39.66  E-value=31  Score=22.86  Aligned_cols=19  Identities=42%  Similarity=0.695  Sum_probs=17.1

Q ss_pred             chhHHHHHHHHHHHHHhCC
Q 028699          114 GSLDALIGRLRAAYEEHGG  132 (205)
Q Consensus       114 GSLDALIGRLRAafEE~Gg  132 (205)
                      .+|+.+|-|||..+++.|+
T Consensus        45 ~~l~~~i~~LR~~l~~~~~   63 (78)
T smart00862       45 NTLDVHISRLRKKLEDDGA   63 (78)
T ss_pred             chHHHHHHHHHHHHhcCCC
Confidence            5799999999999999865


No 30 
>PRK09279 pyruvate phosphate dikinase; Provisional
Probab=39.56  E-value=27  Score=36.12  Aligned_cols=36  Identities=33%  Similarity=0.476  Sum_probs=0.0

Q ss_pred             HHHHHHHhCCC-----------CCCCcc-hhhHHHHHH--HHHHHHHHhh
Q 028699          123 LRAAYEEHGGR-----------PEANPF-GARAVRIFL--REVRDFQAKA  158 (205)
Q Consensus       123 LRAafEE~Gg~-----------pE~NPF-~araVRlYL--ReVRd~QAkA  158 (205)
                      ++..-++.|+.           -|.||| |.|.+|+||  .|+=++|.+|
T Consensus       636 ~~~~a~~~g~~~~k~~~~~~~~~E~NPmLG~RG~Rl~l~~pei~~~QlrA  685 (879)
T PRK09279        636 IEELAEALGLSLEELKARVEALHEFNPMLGHRGCRLGITYPEIYEMQARA  685 (879)
T ss_pred             HHHHHHHcCCCHHHHHHHhcCCCCCCCccccchhhcccCChHHHHHHHHH


No 31 
>PF00140 Sigma70_r1_2:  Sigma-70 factor, region 1.2;  InterPro: IPR009042 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. RNA polymerase recruits alternative sigma factors as a means of switching on specific regulons. Most bacteria express a multiplicity of sigma factors. Two of these factors, sigma-70 (gene rpoD), generally known as the major or primary sigma factor, and sigma-54 (gene rpoN or ntrA) direct the transcription of a wide variety of genes. The other sigma factors, known as alternative sigma factors, are required for the transcription of specific subsets of genes.  With regard to sequence similarity, sigma factors can be grouped into two classes, the sigma-54 and sigma-70 families. Sequence alignments of the sigma70 family members reveal four conserved regions that can be further divided into subregions eg. sub-region 2.2, which may be involved in the binding of the sigma factor to the core RNA polymerase; and sub-region 4.2, which seems to harbor a DNA-binding 'helix-turn-helix' motif involved in binding the conserved -35 region of promoters recognised by the major sigma factors [, ]. ; GO: 0003677 DNA binding, 0003700 sequence-specific DNA binding transcription factor activity, 0016987 sigma factor activity, 0006352 transcription initiation, DNA-dependent, 0006355 regulation of transcription, DNA-dependent; PDB: 1SMY_F 1IW7_P 1SIG_A 3IYD_F 2BE5_F 2A6E_F 2CW0_F 2A69_P 2A6H_P 3DXJ_P ....
Probab=36.31  E-value=29  Score=22.18  Aligned_cols=12  Identities=25%  Similarity=0.758  Sum_probs=10.1

Q ss_pred             hHHHHHHHHHHH
Q 028699          142 RAVRIFLREVRD  153 (205)
Q Consensus       142 raVRlYLReVRd  153 (205)
                      -+|++||++|+.
T Consensus         2 D~l~~Yl~ei~~   13 (37)
T PF00140_consen    2 DSLRLYLKEIGR   13 (37)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             cHHHHHHHHHcC
Confidence            479999999975


No 32 
>PRK06464 phosphoenolpyruvate synthase; Validated
Probab=35.31  E-value=48  Score=33.61  Aligned_cols=15  Identities=40%  Similarity=0.722  Sum_probs=13.7

Q ss_pred             CCCcc-hhhHHHHHHH
Q 028699          135 EANPF-GARAVRIFLR  149 (205)
Q Consensus       135 E~NPF-~araVRlYLR  149 (205)
                      |.||| |.|.||+||.
T Consensus       597 E~NP~LG~RGiR~~l~  612 (795)
T PRK06464        597 EENPMLGFRGASRYLS  612 (795)
T ss_pred             CCCCccccchhhhccc
Confidence            78999 8899999996


No 33 
>cd08793 Death_IRAK4 Death domain of Interleukin-1 Receptor-Associated Kinase 4. Death Domain (DD) of Interleukin-1 Receptor-Associated Kinase 4 (IRAK4). IRAKs are essential components of innate immunity and inflammation in mammals and other vertebrates. They are involved in signal transduction pathways involving IL-1 and IL-18 receptors, Toll-like receptors, nuclear factor-kappaB, and mitogen-activated protein kinases. IRAKs contain an N-terminal DD domain and a C-terminal kinase domain. IRAK4 is an active kinase that is also involved in T-cell receptor signaling pathways, implying that it may function in acquired immunity and not just in innate immunity. It is known as the master IRAK member because its absence strongly impairs TLR- and IL-1-mediated signaling and innate immune defenses, while the absence of other IRAK proteins only shows slight effects. IRAK4-deficient patients have impaired inflammatory responses and recurrent life-threatening infections. DDs are protein-protein int
Probab=35.00  E-value=45  Score=26.45  Aligned_cols=63  Identities=24%  Similarity=0.492  Sum_probs=43.2

Q ss_pred             hHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHH
Q 028699           48 DWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAY  127 (205)
Q Consensus        48 dWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLRAaf  127 (205)
                      +|.++-.++..   |-.-.+.+--||-+|=.+.++              | .+|    +|-|=..||+-++-||.|-..|
T Consensus        23 ~W~~LA~~i~~---~~~~~~y~~~ei~~ie~~~~~--------------g-~SP----T~~LL~dWgt~N~TV~~L~~lL   80 (100)
T cd08793          23 GWKKIAVAIKK---PSGDPRYSQFHIRRFEALVQQ--------------G-KSP----TCELLFDWGTTNCTVGDLVDLL   80 (100)
T ss_pred             cHHHHHHHHhc---ccCCCCCCHHHHHHHHHHHHc--------------C-CCh----HHHHHHHHccCCCcHHHHHHHH
Confidence            78888877755   223344544566666443333              3 222    4567789999999999999999


Q ss_pred             HHhCC
Q 028699          128 EEHGG  132 (205)
Q Consensus       128 EE~Gg  132 (205)
                      .++|-
T Consensus        81 ~k~~l   85 (100)
T cd08793          81 IQNEF   85 (100)
T ss_pred             HHccc
Confidence            99884


No 34 
>cd04372 RhoGAP_chimaerin RhoGAP_chimaerin: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of chimaerins. Chimaerins are a family of phorbolester- and diacylglycerol-responsive GAPs specific for the Rho-like GTPase Rac. Chimaerins exist in two alternative splice forms that each contain a C-terminal GAP domain, and a central C1 domain which binds phorbol esters, inducing a conformational change that activates the protein; one splice form is lacking the N-terminal Src homology-2 (SH2) domain. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GT
Probab=34.75  E-value=47  Score=27.17  Aligned_cols=36  Identities=14%  Similarity=0.400  Sum_probs=26.4

Q ss_pred             HHHHHHHHHHHHhCCCCC---C---Cc-chhhHHHHHHHHHHH
Q 028699          118 ALIGRLRAAYEEHGGRPE---A---NP-FGARAVRIFLREVRD  153 (205)
Q Consensus       118 ALIGRLRAafEE~Gg~pE---~---NP-F~araVRlYLReVRd  153 (205)
                      .-|.+|+..|++.|...+   .   ++ -.|..++.||||.-+
T Consensus        45 ~~i~~l~~~~d~~~~~~~~~~~~~~d~h~va~lLK~flReLP~   87 (194)
T cd04372          45 EEIEDVKMAFDRDGEKADISATVYPDINVITGALKLYFRDLPI   87 (194)
T ss_pred             HHHHHHHHHHcCCCCccCCcccccccHHHHHHHHHHHHHhCCC
Confidence            478889999998775432   1   22 268889999999754


No 35 
>PF11709 Mit_ribos_Mrp51:  Mitochondrial ribosomal protein subunit ;  InterPro: IPR016712 The function of mitochondrial ribosomal small-subunit protein MRP51 is not entirely clear, but deletion of the MRP51 gene completely blocks mitochondrial gene expression [].
Probab=34.68  E-value=58  Score=29.44  Aligned_cols=67  Identities=22%  Similarity=0.235  Sum_probs=48.0

Q ss_pred             CCCCCchhHHhhhhhHHHHHHHHHhcCCCCCC--CCCcchhHhHHHhh-----------------hcccCcccccCCCCC
Q 028699           34 SATTPSRYESQKRRDWNTFCQYLRNHRPPLSL--PMCSGAHVLEFLRY-----------------LDQFGKTKVHNQNCP   94 (205)
Q Consensus        34 ~~~~~SrYesQKRrdWntf~qyL~n~rPPlsL--~~csg~hVleFLry-----------------lDqfGKTkVH~~~C~   94 (205)
                      ....-.+|-++=|..-.+|.+||+.+.|-...  ..--...|.|||..                 ....|..++|.-+=-
T Consensus       144 t~~ef~~yL~kvr~~R~eF~~~L~~~~~e~~~~~~~~l~~~v~eFL~~~~~~~~~~~~~~~~~~~~~~~~~~~~hpsgGL  223 (312)
T PF11709_consen  144 TEGEFERYLKKVRPLRPEFKKWLREKHPESLTFDPSDLYDLVKEFLDLAPLKPPDVPDSKKSSSPYAEAGPPKTHPSGGL  223 (312)
T ss_pred             CHHHHHHHHHHhHHHHHHHHHHHHHhChhhhccCHHHHHHHHHHHHhcccccCcccccchhccCcccccCCCccccCcCc
Confidence            33445678888899999999999999886621  23345678899875                 335677788887777


Q ss_pred             CCCCCC
Q 028699           95 FFGLPN  100 (205)
Q Consensus        95 ffG~p~  100 (205)
                      .|.+++
T Consensus       224 SY~~~g  229 (312)
T PF11709_consen  224 SYNRTG  229 (312)
T ss_pred             CcCCCc
Confidence            776654


No 36 
>TIGR01828 pyru_phos_dikin pyruvate, phosphate dikinase. This model represents pyruvate,phosphate dikinase, also called pyruvate,orthophosphate dikinase. It is similar in sequence to other PEP-utilizing enzymes.
Probab=33.91  E-value=23  Score=36.28  Aligned_cols=25  Identities=36%  Similarity=0.639  Sum_probs=19.2

Q ss_pred             CCCCcc-hhhHHHHHH--HHHHHHHHhh
Q 028699          134 PEANPF-GARAVRIFL--REVRDFQAKA  158 (205)
Q Consensus       134 pE~NPF-~araVRlYL--ReVRd~QAkA  158 (205)
                      -|.||| |.|.||+||  .++=++|.+|
T Consensus       652 ~E~NP~LG~RGiRl~l~~pei~~~QlrA  679 (856)
T TIGR01828       652 HEVNPMLGHRGCRLGITYPEIYEMQVRA  679 (856)
T ss_pred             CCCCCccccchhhhccCChHHHHHHHHH
Confidence            599999 889999999  4555555544


No 37 
>PRK11177 phosphoenolpyruvate-protein phosphotransferase; Provisional
Probab=32.29  E-value=39  Score=33.05  Aligned_cols=36  Identities=33%  Similarity=0.528  Sum_probs=29.7

Q ss_pred             hhHHHHHHHHHHHHHhCCC---------------------CCCCcc-hhhHHHHHHHH
Q 028699          115 SLDALIGRLRAAYEEHGGR---------------------PEANPF-GARAVRIFLRE  150 (205)
Q Consensus       115 SLDALIGRLRAafEE~Gg~---------------------pE~NPF-~araVRlYLRe  150 (205)
                      +-|...--.|.+.+.++++                     -|.||| |-|+||+||..
T Consensus       309 ~eeeq~~~y~~i~~~~~~~~v~iRtlDiGgDK~~~~~~~~~E~NP~LG~RgiR~~l~~  366 (575)
T PRK11177        309 TEEEQFQAYKAVAEAMGSQAVIVRTMDIGGDKELPYMNLPKEENPFLGWRAIRIAMDR  366 (575)
T ss_pred             CHHHHHHHHHHHHHHcCCCeEEEECcCCCcccccccCCCCCCCCcccccchhhhcCCC
Confidence            4677888888888888776                     379999 77999999965


No 38 
>PF01213 CAP_N:  Adenylate cyclase associated (CAP) N terminal;  InterPro: IPR013992  Cyclase-associated proteins (CAPs) are highly conserved actin-binding proteins present in a wide range of organisms including yeast, fly, plants, and mammals. CAPs are multifunctional proteins that contain several structural domains. CAP is involved in species-specific signalling pathways [, , , ]. In Drosophila, CAP functions in Hedgehog-mediated eye development and in establishing oocyte polarity. In Dictyostelium (slim mold), CAP is involved in microfilament reorganisation near the plasma membrane in a PIP2-regulated manner and is required to perpetuate the cAMP relay signal to organise fruitbody formation. In plants, CAP is involved in plant signalling pathways required for co-ordinated organ expansion. In yeast, CAP is involved in adenylate cyclase activation, as well as in vesicle trafficking and endocytosis. In both yeast and mammals, CAPs appear to be involved in recycling G-actin monomers from ADF/cofilins for subsequent rounds of filament assembly [, ]. In mammals, there are two different CAPs (CAP1 and CAP2) that share 64% amino acid identity.  All CAPs appear to contain a C-terminal actin-binding domain that regulates actin remodelling in response to cellular signals and is required for normal cellular morphology, cell division, growth and locomotion in eukaryotes. CAP directly regulates actin filament dynamics and has been implicated in a number of complex developmental and morphological processes, including mRNA localisation and the establishment of cell polarity. Actin exists both as globular (G) (monomeric) actin subunits and assembled into filamentous (F) actin. In cells, actin cycles between these two forms. Proteins that bind F-actin often regulate F-actin assembly and its interaction with other proteins, while proteins that interact with G-actin often control the availability of unpolymerised actin. CAPs bind G-actin.  In addition to actin-binding, CAPs can have additional roles, and may act as bifunctional proteins. In Saccharomyces cerevisiae (Baker's yeast), CAP is a component of the adenylyl cyclase complex (Cyr1p) that serves as an effector of Ras during normal cell signalling. S. cerevisiae CAP functions to expose adenylate cyclase binding sites to Ras, thereby enabling adenylate cyclase to be activated by Ras regulatory signals. In Schizosaccharomyces pombe (Fission yeast), CAP is also required for adenylate cyclase activity, but not through the Ras pathway. In both organisms, the N-terminal domain is responsible for adenylate cyclase activation, but the S cerevisiae and S. pombe N-termini cannot complement one another. Yeast CAPs are unique among the CAP family of proteins, because they are the only ones to directly interact with and activate adenylate cyclase []. S. cerevisiae CAP has four major domains. In addition to the N-terminal adenylate cyclase-interacting domain, and the C-terminal actin-binding domain, it possesses two other domains: a proline-rich domain that interacts with Src homology 3 (SH3) domains of specific proteins, and a domain that is responsible for CAP oligomerisation to form multimeric complexes (although oligomerisation appears to involve the N- and C-terminal domains as well). The proline-rich domain interacts with profilin, a protein that catalyses nucleotide exchange on G-actin monomers and promotes addition to barbed ends of filamentous F-actin []. Since CAP can bind profilin via a proline-rich domain, and G-actin via a C-terminal domain, it has been suggested that a ternary G-actin/CAP/profilin complex could be formed. This entry represents the N-terminal domain of CAP proteins. This domain has an all-alpha structure consisting of six helices in a bundle with a left-handed twist and an up-and-down topology [].; GO: 0003779 actin binding, 0007010 cytoskeleton organization; PDB: 1TJF_B 1S0P_A.
Probab=31.90  E-value=59  Score=29.76  Aligned_cols=53  Identities=23%  Similarity=0.354  Sum_probs=36.9

Q ss_pred             hhhhcchhHHHHHHHHHHHHHhCCCCCCCcchhhHHHHHHHHHHHHHHhh-----hCcchhhhh
Q 028699          109 LRQAWGSLDALIGRLRAAYEEHGGRPEANPFGARAVRIFLREVRDFQAKA-----RGVSYDKKR  167 (205)
Q Consensus       109 lRQAWGSLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkA-----Rgi~y~kk~  167 (205)
                      ....|++-+-..-|+.--|.+      .||--...||.|+.-..+.|+=.     -|+.+-+|-
T Consensus       156 V~e~~dsA~Fy~NRVLke~K~------kd~~hveWvks~~~l~~~L~~YVke~httGl~WN~~G  213 (312)
T PF01213_consen  156 VKEMKDSAQFYTNRVLKEYKE------KDPKHVEWVKSFKALLKELQAYVKEHHTTGLSWNPKG  213 (312)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTT------T-HHHHHHHHHHHHHHHHHHHHHHHHSTTS----TTS
T ss_pred             HHHHHHHHHHHHhHHHHHhhh------ccchhHHHHHHHHHHHHHHHHHHHHhCccCcccCCcc
Confidence            456677777788887777765      57888899999999999988753     478877665


No 39 
>cd04396 RhoGAP_fSAC7_BAG7 RhoGAP_fSAC7_BAG7: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal SAC7 and BAG7-like proteins. Both proteins are GTPase activating proteins of Rho1, but differ functionally in vivo: SAC7, but not BAG7, is involved in the control of Rho1-mediated activation of the PKC-MPK1 pathway. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=31.78  E-value=2e+02  Score=24.29  Aligned_cols=37  Identities=14%  Similarity=0.252  Sum_probs=25.7

Q ss_pred             HHHHHHHHHHHHHhC---CCCCCCcc----hhhHHHHHHHHHHH
Q 028699          117 DALIGRLRAAYEEHG---GRPEANPF----GARAVRIFLREVRD  153 (205)
Q Consensus       117 DALIGRLRAafEE~G---g~pE~NPF----~araVRlYLReVRd  153 (205)
                      -+-|.+|+.+|++..   ..-+-+.+    .+..++.|||+.-+
T Consensus        60 ~~~i~~L~~~~d~~~~~~~~~~~~~~~vh~va~lLK~fLReLPe  103 (225)
T cd04396          60 SKRIRELQLIFSTPPDYGKSFDWDGYTVHDAASVLRRYLNNLPE  103 (225)
T ss_pred             HHHHHHHHHHHccCcccCCcCCccCCCHHHHHHHHHHHHHhCCC
Confidence            357889999998753   22222222    68899999999744


No 40 
>PF09107 SelB-wing_3:  Elongation factor SelB, winged helix ;  InterPro: IPR015191 This entry represents a domain with a winged helix-type fold, which consists of a closed 3-helical bundle with a right-handed twist, and a small beta-sheet wing []. Different winged helix domains share a common structure, but can differ in sequence. This entry is designated "type 3".  The winged helix motif is involved in both DNA and RNA binding. In the elongation factor SelB, the winged helix domains recognise RNA, allowing the complex to wrap around the small ribosomal subunit. In bacteria, the incorporation of the amino acid selenocysteine into proteins requires elongation factor SelB, which binds both transfer RNA (tRNA) and mRNA. SelB binds to an mRNA hairpin formed by the selenocysteine insertion sequence (SECIS) with extremely high specificity []. ; GO: 0003723 RNA binding, 0003746 translation elongation factor activity, 0005525 GTP binding, 0001514 selenocysteine incorporation, 0005737 cytoplasm; PDB: 2PJP_A 2UWM_A 1WSU_B 1LVA_A 2PLY_A.
Probab=31.32  E-value=25  Score=24.27  Aligned_cols=20  Identities=35%  Similarity=0.496  Sum_probs=16.8

Q ss_pred             CcchhHhHHHhhhcccCccc
Q 028699           68 CSGAHVLEFLRYLDQFGKTK   87 (205)
Q Consensus        68 csg~hVleFLrylDqfGKTk   87 (205)
                      .|=+-++-+|.|+|+.|.|+
T Consensus        22 ~sRK~ai~lLE~lD~~g~T~   41 (50)
T PF09107_consen   22 LSRKYAIPLLEYLDREGITR   41 (50)
T ss_dssp             S-HHHHHHHHHHHHHTTSEE
T ss_pred             ccHHHHHHHHHHHhccCCEE
Confidence            45677899999999999987


No 41 
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional
Probab=31.09  E-value=39  Score=26.35  Aligned_cols=16  Identities=38%  Similarity=0.536  Sum_probs=10.8

Q ss_pred             hhHHHHHHHHHHHHHh
Q 028699          115 SLDALIGRLRAAYEEH  130 (205)
Q Consensus       115 SLDALIGRLRAafEE~  130 (205)
                      +||.+|.|||.-+++.
T Consensus       201 ~i~~~i~rlR~kl~~~  216 (240)
T PRK10701        201 SVDVAISRLRKKLLDN  216 (240)
T ss_pred             CHHHHHHHHHHhcccC
Confidence            4677777777777643


No 42 
>smart00243 GAS2 Growth-Arrest-Specific Protein 2 Domain. GROWTH-ARREST-SPECIFIC PROTEIN 2 Domain
Probab=30.97  E-value=34  Score=26.14  Aligned_cols=14  Identities=43%  Similarity=0.997  Sum_probs=13.1

Q ss_pred             hHHHHHHHHHhcCC
Q 028699           48 DWNTFCQYLRNHRP   61 (205)
Q Consensus        48 dWntf~qyL~n~rP   61 (205)
                      -|.||.+||..|.|
T Consensus        55 GW~tL~~fL~khDP   68 (73)
T smart00243       55 GWETLDEYLLKHDP   68 (73)
T ss_pred             cHHHHHHHHHhCCC
Confidence            39999999999998


No 43 
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=30.92  E-value=81  Score=31.19  Aligned_cols=25  Identities=24%  Similarity=0.331  Sum_probs=22.0

Q ss_pred             CCCcchhhHHHHHHHHHHHHHHhhh
Q 028699          135 EANPFGARAVRIFLREVRDFQAKAR  159 (205)
Q Consensus       135 E~NPF~araVRlYLReVRd~QAkAR  159 (205)
                      +.+|+.-..||-||...-+.|+-.|
T Consensus       180 ~~D~~hveWvKa~l~l~~eL~~YVk  204 (480)
T KOG2675|consen  180 EKDPRHVEWVKAYLALFLELQAYVK  204 (480)
T ss_pred             cCChhHHHHHHHHHHHHHHHHHHHH
Confidence            4799999999999999999998655


No 44 
>cd00383 trans_reg_C Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and a response regulator. The former autophosphorylates in a histidine residue on detecting an external stimulus. The phosphate is then transferred to an invariant aspartate residue in a highly conserved receiver domain of the response regulator. Phosphorylation activates a variable effector domain of the response regulator, which triggers the cellular response. The C-terminal effector domain contains DNA and RNA polymerase binding sites. Several dimers or monomers bind head to tail to small tandem repeats upstream of the genes. The RNA polymerase binding sites interact with the alpha or sigma subunite of RNA polymerase.
Probab=29.48  E-value=47  Score=22.84  Aligned_cols=20  Identities=30%  Similarity=0.468  Sum_probs=17.2

Q ss_pred             chhHHHHHHHHHHHHHhCCC
Q 028699          114 GSLDALIGRLRAAYEEHGGR  133 (205)
Q Consensus       114 GSLDALIGRLRAafEE~Gg~  133 (205)
                      .+|+.+|-|||..+.+.|+.
T Consensus        62 ~~l~~~I~rLRkkl~~~~~~   81 (95)
T cd00383          62 RTVDVHISRLRKKLEDDPSN   81 (95)
T ss_pred             ccHHHHHHHHHHHhccCCCC
Confidence            57999999999999987653


No 45 
>PF08544 GHMP_kinases_C:  GHMP kinases C terminal ;  InterPro: IPR013750 This domain is found in homoserine kinases (2.7.1.39 from EC), galactokinases (2.7.1.6 from EC) and mevalonate kinases (2.7.1.36 from EC). These kinases make up the GHMP kinase superfamily of ATP-dependent enzymes []. These enzymes are involved in the biosynthesis of isoprenes and amino acids as well as in carbohydrate metabolism. The C-terminal domain of homoserine kinase has a central alpha-beta plait fold and an insertion of four helices, which, together with the N-terminal fold, create a novel nucleotide binding fold [].; PDB: 2R3V_C 4EMD_A 4DXL_A 4ED4_A 2GS8_A 1K47_E 3GON_A 3K17_B 1PIE_A 2AJ4_A ....
Probab=29.26  E-value=7.2  Score=26.50  Aligned_cols=72  Identities=14%  Similarity=0.187  Sum_probs=44.8

Q ss_pred             hhhhHHHHHHHHHhcCC--CCCCCCCcchhHhHHHhhhcccC--cccccC---CCCCCCCCCCCCCCCCCchhhhcchhH
Q 028699           45 KRRDWNTFCQYLRNHRP--PLSLPMCSGAHVLEFLRYLDQFG--KTKVHN---QNCPFFGLPNPPAPCPCPLRQAWGSLD  117 (205)
Q Consensus        45 KRrdWntf~qyL~n~rP--PlsL~~csg~hVleFLrylDqfG--KTkVH~---~~C~ffG~p~ppapC~CPlRQAWGSLD  117 (205)
                      ++.||..|.+.+.+..-  +.....+...+|.+.+.++-+.|  -+++-.   -+|.|-            |=.--...|
T Consensus         6 ~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~Ga~~~~~sGsG~G~~v~~------------l~~~~~~~~   73 (85)
T PF08544_consen    6 AEGDLELLGELMNENQENEPENYREVLTPEIDELKEAAEENGALGAKMSGSGGGPTVFA------------LCKDEDDAE   73 (85)
T ss_dssp             HTTCHHHHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHTTESEEEEETTSSSSEEEE------------EESSHHHHH
T ss_pred             HCcCHHHHHHHHHHhhhhcchHHHHHcCHHHHHHHHHHHHCCCCceecCCCCCCCeEEE------------EECCHHHHH
Confidence            56899999999995543  44455667788888888888887  333321   333321            111223566


Q ss_pred             HHHHHHHHHHH
Q 028699          118 ALIGRLRAAYE  128 (205)
Q Consensus       118 ALIGRLRAafE  128 (205)
                      .++-+|++.|+
T Consensus        74 ~v~~~l~~~~~   84 (85)
T PF08544_consen   74 RVAEALREHYK   84 (85)
T ss_dssp             HHHHHHHHHTH
T ss_pred             HHHHHHHHhCC
Confidence            67777776664


No 46 
>PF09336 Vps4_C:  Vps4 C terminal oligomerisation domain;  InterPro: IPR015415 This domain is found at the C-terminal of ATPase proteins involved in vacuolar sorting. It forms an alpha helix structure and is required for oligomerisation []. ; PDB: 1XWI_A 3EIH_C 2QPA_C 3EIE_A 2RKO_A 2QP9_X 3MHV_C 3CF3_C 3CF1_A 3CF2_A ....
Probab=29.18  E-value=48  Score=23.48  Aligned_cols=31  Identities=19%  Similarity=0.448  Sum_probs=24.4

Q ss_pred             HHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccC
Q 028699           49 WNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFG   84 (205)
Q Consensus        49 Wntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfG   84 (205)
                      -+.|.+=|++.+|     +.|.+||..|..|-.+||
T Consensus        32 ~~DF~~Al~~~kp-----SVs~~dl~~ye~w~~~FG   62 (62)
T PF09336_consen   32 MEDFEEALKKVKP-----SVSQEDLKKYEEWTKEFG   62 (62)
T ss_dssp             HHHHHHHHHTCGG-----SS-HHHHHHHHHHHHHTS
T ss_pred             HHHHHHHHHHcCC-----CCCHHHHHHHHHHHHHcC
Confidence            4557777777777     556899999999999998


No 47 
>PRK11235 bifunctional antitoxin/transcriptional repressor RelB; Provisional
Probab=28.99  E-value=1.4e+02  Score=22.52  Aligned_cols=38  Identities=29%  Similarity=0.447  Sum_probs=29.6

Q ss_pred             HHHHHHHHHHHHhCCCCCCCcchhhHHHHHHHHHHHHHHhhhCcchhh
Q 028699          118 ALIGRLRAAYEEHGGRPEANPFGARAVRIFLREVRDFQAKARGVSYDK  165 (205)
Q Consensus       118 ALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkARgi~y~k  165 (205)
                      .|--+.-++|+++|-.+      +.||++||+.|    ++.+|||++.
T Consensus        11 ~lK~~A~~vl~~lGls~------S~Ai~~fl~qi----~~~~~iPF~~   48 (80)
T PRK11235         11 ELKARAYAVLEKLGVTP------SEALRLLLQYV----AENGRLPFKT   48 (80)
T ss_pred             HHHHHHHHHHHHhCCCH------HHHHHHHHHHH----HHhCCCCCCC
Confidence            45556778999999874      67999999987    4558888874


No 48 
>PF03801 Ndc80_HEC:  HEC/Ndc80p family;  InterPro: IPR005550 Members of this family are components of the mitotic spindle. It has been shown that Ndc80 from yeast is part of a complex called the Ndc80p complex []. This complex is thought to bind to the microtubules of the spindle.; PDB: 3IZ0_E 2VE7_B 2IGP_A.
Probab=28.69  E-value=1.1e+02  Score=24.88  Aligned_cols=46  Identities=17%  Similarity=0.292  Sum_probs=28.4

Q ss_pred             CCCCchhHHhhhhhHHHHHHHHHhcCC------CCCCCCCcchhHhHHHhhh
Q 028699           35 ATTPSRYESQKRRDWNTFCQYLRNHRP------PLSLPMCSGAHVLEFLRYL   80 (205)
Q Consensus        35 ~~~~SrYesQKRrdWntf~qyL~n~rP------PlsL~~csg~hVleFLryl   80 (205)
                      .++|-+=++-+..-++++.+||..+--      +..|...+.+++++.+.+|
T Consensus        28 d~Rpl~Dk~~q~~~~~~I~~fL~~~~~~~~~is~k~l~~Pt~kdf~~I~~fL   79 (157)
T PF03801_consen   28 DPRPLSDKSYQQECIRKIYEFLSEHGFESHPISPKTLKSPTQKDFVEIFNFL   79 (157)
T ss_dssp             --S-TT-HHHHHHHHHHHHHHHHHTT--SS---TTTTSS--HHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHHHHHcCCCCccccccccCCCCHHHHHHHHHHH
Confidence            355555556667788999999987665      5666778888877665554


No 49 
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]
Probab=28.14  E-value=46  Score=28.27  Aligned_cols=27  Identities=37%  Similarity=0.667  Sum_probs=21.6

Q ss_pred             chhhhcc--------hhHHHHHHHHHHHHHhCCCC
Q 028699          108 PLRQAWG--------SLDALIGRLRAAYEEHGGRP  134 (205)
Q Consensus       108 PlRQAWG--------SLDALIGRLRAafEE~Gg~p  134 (205)
                      -+.+.||        +||..|+|||.-+++.++.+
T Consensus       178 L~~~vw~~~~~~~~rtvdvhI~rLR~Kl~~~~~~~  212 (229)
T COG0745         178 LLEAVWGYDFEVDSRTVDVHISRLRKKLEKDPGAG  212 (229)
T ss_pred             HHHHhcCCCCCCCccCHHHHHHHHHHHhccCCCCC
Confidence            3667777        49999999999999887643


No 50 
>PTZ00398 phosphoenolpyruvate carboxylase; Provisional
Probab=27.81  E-value=1.1e+02  Score=32.25  Aligned_cols=43  Identities=21%  Similarity=0.373  Sum_probs=32.1

Q ss_pred             cchhHHHHHHHHHHHHHhCC------------------CCCCCcch-------------hhHHHHHHHHHHHHH
Q 028699          113 WGSLDALIGRLRAAYEEHGG------------------RPEANPFG-------------ARAVRIFLREVRDFQ  155 (205)
Q Consensus       113 WGSLDALIGRLRAafEE~Gg------------------~pE~NPF~-------------araVRlYLReVRd~Q  155 (205)
                      |-.+=.|..+|+.+++++|+                  .=++|||.             ..|+++|+++|++.-
T Consensus       264 ~~aiP~~~~~l~~al~~~~~~~~~~~~~~i~fGSWiGGDRDGNP~VTaevT~~~l~~~r~~al~~Y~~~l~~L~  337 (974)
T PTZ00398        264 FDALPNFIRYIDNVLYEYNLDPLPPTKKLFTFSSWVGGDRDGNPFVTAEVTRQVVYFNRIRACELFIHMIEKLM  337 (974)
T ss_pred             HHHHHHHHHHHHHHHHHhcCCCCCCCCCceeccCCCCCCCCCCCcCcHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            44566788899999988754                  23499996             357889999988753


No 51 
>PF09674 DUF2400:  Protein of unknown function (DUF2400);  InterPro: IPR014127 Members of this uncharacterised protein family are found sporadically, so far only among spirochetes, epsilon and delta proteobacteria, and Bacteroides. The function is unknown and its gene neighbourhoods show little conservation.
Probab=27.32  E-value=55  Score=28.85  Aligned_cols=52  Identities=15%  Similarity=0.276  Sum_probs=38.8

Q ss_pred             hhhcchhHHHHHHHHHHHHHhCCCCC--------------CCcc-----hhhHHHHHHHHHHHHHHhhhCc
Q 028699          110 RQAWGSLDALIGRLRAAYEEHGGRPE--------------ANPF-----GARAVRIFLREVRDFQAKARGV  161 (205)
Q Consensus       110 RQAWGSLDALIGRLRAafEE~Gg~pE--------------~NPF-----~araVRlYLReVRd~QAkARgi  161 (205)
                      -.|||.+..+|-.|..+|+.+|..|-              -+-|     ...-+..+|..++..-.+.-+|
T Consensus        24 ~lAyG~~~~I~~~~~~ll~~~~~~P~~~v~~~~~~~~~~~~~~~~yRf~~~~D~~~~~~~l~~i~~~~gsL   94 (232)
T PF09674_consen   24 LLAYGNRKQIIKKLERLLDLMGPSPYDFVLSGDEKDDRKDLEGFFYRFQNGEDMYAFFIALKRIYQEYGSL   94 (232)
T ss_pred             HHHccCHHHHHHHHHHHHHHhCCCHHHHHHcCCHhhhHHHccCCCcCCCCHHHHHHHHHHHHHHHHccCCH
Confidence            36999999999999999999999862              2333     3445667777777766665555


No 52 
>PRK09468 ompR osmolarity response regulator; Provisional
Probab=26.92  E-value=50  Score=25.60  Aligned_cols=17  Identities=47%  Similarity=0.579  Sum_probs=13.0

Q ss_pred             hhHHHHHHHHHHHHHhC
Q 028699          115 SLDALIGRLRAAYEEHG  131 (205)
Q Consensus       115 SLDALIGRLRAafEE~G  131 (205)
                      +||..|.|||.-++..+
T Consensus       201 ~l~~~i~~LR~kl~~~~  217 (239)
T PRK09468        201 SIDVQISRLRRLIEEDP  217 (239)
T ss_pred             CHHHHHHHHHHHhccCC
Confidence            68888888888886543


No 53 
>TIGR02249 integrase_gron integron integrase. Members of this family are integrases associated with integrons (and super-integrons), which are systems for incorporating and expressing cassettes of laterally transferred DNA. Incorporation occurs at an attI site. A super-integron, as in Vibrio sp., may include over 100 cassettes. This family belongs to the phage integrase family (pfam00589) that also includes recombinases XerC (TIGR02224) and XerD (TIGR02225), which are bacterial housekeeping proteins. Within this family of integron integrases, some are designated by class, e.g. IntI4, a class 4 integron integrase from Vibrio cholerae N16961.
Probab=26.72  E-value=1.2e+02  Score=25.13  Aligned_cols=33  Identities=15%  Similarity=0.105  Sum_probs=24.2

Q ss_pred             hhhHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcc
Q 028699           46 RRDWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQ   82 (205)
Q Consensus        46 RrdWntf~qyL~n~rPPlsL~~csg~hVleFLrylDq   82 (205)
                      ...++.|.+|+.+    +.+..-+..||.+||.++-+
T Consensus        23 ~~~~~~~~~~~g~----~~~~~it~~~i~~~l~~l~~   55 (315)
T TIGR02249        23 LHWIKRFIRFHNK----RHPSTMGDTEVEAFLSDLAV   55 (315)
T ss_pred             HHHHHHHHHHhCC----CChHhcCHHHHHHHHHHHHh
Confidence            3577778888642    34566789999999999854


No 54 
>cd04388 RhoGAP_p85 RhoGAP_p85: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in the p85 isoforms of the regulatory subunit of the class IA PI3K (phosphatidylinositol 3'-kinase). This domain is also called Bcr (breakpoint cluster region protein) homology (BH) domain. Class IA PI3Ks are heterodimers, containing a regulatory subunit (p85) and a catalytic subunit (p110) and are activated by growth factor receptor tyrosine kinases (RTKs); this activation is mediated by the p85 subunit. p85 isoforms, alpha and beta, contain a C-terminal p110-binding domain flanked by two SH2 domains, an N-terminal SH3 domain, and a RhoGAP domain flanked by two proline-rich regions. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell p
Probab=26.72  E-value=84  Score=26.87  Aligned_cols=34  Identities=15%  Similarity=0.231  Sum_probs=24.3

Q ss_pred             HHHHHHHHHHhCCCCCC---Ccc-hhhHHHHHHHHHHH
Q 028699          120 IGRLRAAYEEHGGRPEA---NPF-GARAVRIFLREVRD  153 (205)
Q Consensus       120 IGRLRAafEE~Gg~pE~---NPF-~araVRlYLReVRd  153 (205)
                      +-.||.+||+.+...+-   ++. .+.+++.|||+.-|
T Consensus        45 ~~~lk~~~d~~~~~~d~~~~dv~~va~~LK~ylReLPe   82 (200)
T cd04388          45 LTELRQILDCDAASVDLEQFDVAALADALKRYLLDLPN   82 (200)
T ss_pred             HHHHHHHHhcCCCCCCcccccHHHHHHHHHHHHHhCCC
Confidence            45689999986554432   222 78999999998754


No 55 
>PRK05084 xerS site-specific tyrosine recombinase XerS; Reviewed
Probab=26.68  E-value=1.2e+02  Score=25.70  Aligned_cols=68  Identities=13%  Similarity=0.202  Sum_probs=43.2

Q ss_pred             hhhHHHHHHHHHhcCC-----CC-----CCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcch
Q 028699           46 RRDWNTFCQYLRNHRP-----PL-----SLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGS  115 (205)
Q Consensus        46 RrdWntf~qyL~n~rP-----Pl-----sL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGS  115 (205)
                      +++...|.+||..+..     ..     .|...+..||.+|+.|+.+.-..      +   ++.+       +...+..|
T Consensus        42 ~~~l~~f~~~l~~~~~~~~~~~~~~~~~~l~~lt~~~i~~f~~~l~~~~~~------~---~~~~-------~~~~s~~T  105 (357)
T PRK05084         42 LTEYRRFFNWLISEGLSDASKIKDIPLSTLENLTKKDVEAFILYLRERPLL------N---GHST-------KKGNSQTT  105 (357)
T ss_pred             HHHHHHHHHHHHHcCCCCcCCcccCCHHHHHhhhHHHHHHHHHHHHhcccc------c---cccc-------ccchhHHH
Confidence            3556778888876542     11     23467899999999998542110      0   0000       01246688


Q ss_pred             hHHHHHHHHHHHHH
Q 028699          116 LDALIGRLRAAYEE  129 (205)
Q Consensus       116 LDALIGRLRAafEE  129 (205)
                      +...++-||++|.-
T Consensus       106 i~~~l~~l~~~~~~  119 (357)
T PRK05084        106 INRTLSALKSLFKY  119 (357)
T ss_pred             HHHHHHHHHHHHHH
Confidence            99999999999984


No 56 
>PF10520 Kua-UEV1_localn:  Kua-ubiquitin conjugating enzyme hybrid localisation domain;  InterPro: IPR019547  This entry represents part of the transcript of the fusion of two genes, the UEV1.  UEV1 is an enzymatically inactive variant of the E2 ubiquitin-conjugating enzymes that regulate non-canonical elongation of ubiquitin chains, and Kua, an otherwise unknown gene. UEV1A is a nuclear protein, whereas both Kua and Kua-UEV localise to cytoplasmic structures, indicating that the addition of a Kua domain to UEV confers new biological properties. UEV1-Kua carries the B domain with its characteristic double histidine motif, and it is probably this domain which determines the cytoplasmic localisation. It is postulated that this hybrid transcript could preferentially direct the variant polyubiquitination of substrates closely associated with the cytoplasmic face of the endoplasmic reticulum, possibly, although not necessarily, in conjunction with membrane-bound ubiquitin-conjugating enzymes []. 
Probab=26.46  E-value=31  Score=29.44  Aligned_cols=24  Identities=38%  Similarity=0.815  Sum_probs=21.8

Q ss_pred             hcchhHH-HHHHHHHHHHHhCCCCC
Q 028699          112 AWGSLDA-LIGRLRAAYEEHGGRPE  135 (205)
Q Consensus       112 AWGSLDA-LIGRLRAafEE~Gg~pE  135 (205)
                      -|||+|- |||+.-++|.||-..|-
T Consensus        17 ~~Gs~~tpi~G~~I~~Fr~HH~~P~   41 (178)
T PF10520_consen   17 NWGSPDTPIIGKFIRPFREHHVDPT   41 (178)
T ss_pred             cCCCCccchhhHHhHHHHHcccCHH
Confidence            5899998 89999999999999875


No 57 
>cd01187 INT_SG4 INT_SG4, DNA breaking-rejoining enzymes, integrase/recombinases subgroup 4, N- and C-terminal domains. The CD contains mainly predicted bacterial integrase/recombinases for which not much biochemical characterization is available.
Probab=26.23  E-value=3e+02  Score=22.46  Aligned_cols=59  Identities=12%  Similarity=0.105  Sum_probs=37.1

Q ss_pred             hHHHHHHHHHhcCCCCCCCCCcchhHhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHH
Q 028699           48 DWNTFCQYLRNHRPPLSLPMCSGAHVLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAY  127 (205)
Q Consensus        48 dWntf~qyL~n~rPPlsL~~csg~hVleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLRAaf  127 (205)
                      .-+.|.+|+.++.    +...+..||.+|+.++..                            .+-.++...+.-||+.|
T Consensus        25 ~~~~f~~~~~~~~----~~~it~~~~~~~~~~~~~----------------------------~~~~t~~~~l~~l~~~~   72 (299)
T cd01187          25 LLRDFVRFLERHG----AGFITTDLALRWAASPPS----------------------------AQPATWAGRLGVVRRFA   72 (299)
T ss_pred             HHHHHHHHHHhCC----CCCCCHHHHHHHHhcCCC----------------------------CChHHHHHHHHHHHHHH
Confidence            4456888887654    567788888888765311                            12245666777777777


Q ss_pred             H---HhCCCCCCCcc
Q 028699          128 E---EHGGRPEANPF  139 (205)
Q Consensus       128 E---E~Gg~pE~NPF  139 (205)
                      .   +.|. -+.||+
T Consensus        73 ~~~~~~~~-~~~~p~   86 (299)
T cd01187          73 RHRRRADP-RTEVPP   86 (299)
T ss_pred             HHHHhCCC-CccCCC
Confidence            7   2233 345776


No 58 
>PF09958 DUF2192:  Uncharacterized protein conserved in archaea (DUF2192);  InterPro: IPR018693 This family of various hypothetical archaeal proteins has no known function.
Probab=26.21  E-value=57  Score=29.34  Aligned_cols=21  Identities=38%  Similarity=0.577  Sum_probs=18.4

Q ss_pred             hhHHHHHHHHHHHHHhCCCCC
Q 028699          115 SLDALIGRLRAAYEEHGGRPE  135 (205)
Q Consensus       115 SLDALIGRLRAafEE~Gg~pE  135 (205)
                      +=+.||.-||..|+++|..|=
T Consensus        27 ~R~~lv~~L~~~Y~~~gIeP~   47 (231)
T PF09958_consen   27 DREELVELLREVYEENGIEPF   47 (231)
T ss_pred             CHHHHHHHHHHHHHHcCCCcC
Confidence            558999999999999998864


No 59 
>PF07535 zf-DBF:  DBF zinc finger;  InterPro: IPR006572 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  In eukaryotes, initiation of DNA replication requires the assembly of pre-replication complexes (pre-RCs) on chromatin during the G1 phase. In the S phase, pre-RCs are activated by two protein kinases, Cdk2 and Cdc7, which results in the loading of replication factors and the unwinding of replication origins by the MCM helicase complex []. Cdc7 is a serine/threonine kinase that is conserved from yeast to human. It is regulated by its association with a regulatory subunit, the Dbf4 protein. This complex is often referred to as DDK (Dbf4-dependent kinase) []. DBF4 contains an N-terminal BRCT domain and a C-terminal conserved region that could potentially coordinate one zinc atom, the DBF4-type zinc finger. This entry represents the zinc finger, which is important for the interaction with Cdc7 [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding
Probab=26.07  E-value=34  Score=23.83  Aligned_cols=12  Identities=42%  Similarity=0.775  Sum_probs=10.5

Q ss_pred             cchhHHHHHHHH
Q 028699          113 WGSLDALIGRLR  124 (205)
Q Consensus       113 WGSLDALIGRLR  124 (205)
                      |-.||.||.+|.
T Consensus        37 f~~lD~li~~l~   48 (49)
T PF07535_consen   37 FKELDSLISQLQ   48 (49)
T ss_pred             HHHHHHHHHHhc
Confidence            789999999885


No 60 
>PF00179 UQ_con:  Ubiquitin-conjugating enzyme;  InterPro: IPR000608 The post-translational attachment of ubiquitin (IPR000626 from INTERPRO) to proteins (ubiquitinylation) alters the function, location or trafficking of a protein, or targets it to the 26S proteasome for degradation [, , ]. Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade []. The E1 enzyme mediates an ATP-dependent transfer of a thioester-linked ubiquitin molecule to a cysteine residue on the E2 enzyme. The E2 enzyme (6.3.2.19 from EC) then either transfers the ubiquitin moiety directly to a substrate, or to an E3 ligase, which can also ubiquitinylate a substrate. There are several different E2 enzymes (over 30 in humans), which are broadly grouped into four classes, all of which have a core catalytic domain (containing the active site cysteine), and some of which have short N- and C-terminal amino acid extensions: class I enzymes consist of just the catalytic core domain (UBC), class II possess a UBC and a C-terminal extension, class III possess a UBC and an N-terminal extension, and class IV possess a UBC and both N- and C-terminal extensions. These extensions appear to be important for some subfamily function, including E2 localisation and protein-protein interactions []. In addition, there are proteins with an E2-like fold that are devoid of catalytic activity, but which appear to assist in poly-ubiquitin chain formation.; GO: 0016881 acid-amino acid ligase activity; PDB: 2AAK_A 3SY2_C 1FBV_C 3SQV_C 1C4Z_D 1JAT_B 2GMI_B 2H2Y_D 2R0J_A 3E95_B ....
Probab=25.50  E-value=1.6e+02  Score=22.53  Aligned_cols=45  Identities=18%  Similarity=0.551  Sum_probs=36.2

Q ss_pred             hcc---hhHHHHHHHHHHHHHhCCCCCCCcchhhHHHHHHHHHHHHHHhhh
Q 028699          112 AWG---SLDALIGRLRAAYEEHGGRPEANPFGARAVRIFLREVRDFQAKAR  159 (205)
Q Consensus       112 AWG---SLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkAR  159 (205)
                      -|-   ++..+|--|++.+.+-   -..+|+-..|.++|..+-.+.+.+||
T Consensus        90 ~W~p~~~i~~il~~i~~ll~~p---~~~~~~n~~a~~~~~~~~~~f~~~~~  137 (140)
T PF00179_consen   90 SWSPSYTIESILLSIQSLLSEP---NPEDPLNEEAAELYKNDREEFEKKAR  137 (140)
T ss_dssp             TC-TTSHHHHHHHHHHHHHHST---CTTSTSSHHHHHHHHHCHHHHHHHHH
T ss_pred             cCCcccccccHHHHHHHHHhCC---CCCCcchHHHHHHHHHCHHHHHHHHH
Confidence            377   8888888999999554   45788999999999998777777776


No 61 
>PRK11173 two-component response regulator; Provisional
Probab=25.38  E-value=55  Score=25.52  Aligned_cols=19  Identities=26%  Similarity=0.487  Sum_probs=16.0

Q ss_pred             hhHHHHHHHHHHHHHhCCC
Q 028699          115 SLDALIGRLRAAYEEHGGR  133 (205)
Q Consensus       115 SLDALIGRLRAafEE~Gg~  133 (205)
                      +||..|.|||.-+++.+..
T Consensus       200 ~~~~~i~rlR~kl~~~~~~  218 (237)
T PRK11173        200 TVDVTIRRIRKHFESTPDT  218 (237)
T ss_pred             cHHHHHHHHHHHhccCCCC
Confidence            8999999999999865543


No 62 
>PF06947 DUF1290:  Protein of unknown function (DUF1290);  InterPro: IPR009709 This family consists of several bacterial small basic proteins of around 100 residues in length. The function of this family is unknown.
Probab=25.18  E-value=62  Score=25.49  Aligned_cols=17  Identities=35%  Similarity=0.739  Sum_probs=15.2

Q ss_pred             chhHHHHHHHHHHHHHh
Q 028699          114 GSLDALIGRLRAAYEEH  130 (205)
Q Consensus       114 GSLDALIGRLRAafEE~  130 (205)
                      ..||++.|-+||..|++
T Consensus        16 AaLDsvfGgiRA~le~~   32 (88)
T PF06947_consen   16 AALDSVFGGIRASLEDK   32 (88)
T ss_pred             HHHHHHHHHHHHHHHhh
Confidence            46999999999999975


No 63 
>TIGR02384 RelB_DinJ addiction module antitoxin, RelB/DinJ family. Plasmids may be maintained stably in bacterial populations through the action of addiction modules, in which a toxin and antidote are encoded in a cassette on the plasmid. In any daughter cell that lacks the plasmid, the toxin persists and is lethal after the antidote protein is depleted. Toxin/antitoxin pairs are also found on main chromosomes, and likely represent selfish DNA. Sequences in the seed for this alignment all were found adjacent to toxin genes. The resulting model appears to describe a narrower set of proteins than Pfam model pfam04221, although many in the scope of this model are not obviously paired with toxin proteins. Several toxin/antitoxin pairs may occur in a single species.
Probab=24.64  E-value=2e+02  Score=21.30  Aligned_cols=39  Identities=33%  Similarity=0.647  Sum_probs=30.1

Q ss_pred             HHHHHHHHHHHHhCCCCCCCcchhhHHHHHHHHHHHHHHhhhCcchhhh
Q 028699          118 ALIGRLRAAYEEHGGRPEANPFGARAVRIFLREVRDFQAKARGVSYDKK  166 (205)
Q Consensus       118 ALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkARgi~y~kk  166 (205)
                      .|--..-++|+++|..+      ..|||++|+.|    ++-+|||++-+
T Consensus        12 ~lK~~a~~i~~~lGl~~------s~ai~~fl~qv----v~~~~lPF~~~   50 (83)
T TIGR02384        12 ELKKEAYAVFEELGLTP------STAIRMFLKQV----IREQGLPFDLR   50 (83)
T ss_pred             HHHHHHHHHHHHhCCCH------HHHHHHHHHHH----HHhCCCCCCcC
Confidence            34556678899999874      57999999976    45589999875


No 64 
>PLN02837 threonine-tRNA ligase
Probab=24.44  E-value=30  Score=33.57  Aligned_cols=15  Identities=40%  Similarity=0.603  Sum_probs=11.6

Q ss_pred             hhhcchhHHHHHHHH
Q 028699          110 RQAWGSLDALIGRLR  124 (205)
Q Consensus       110 RQAWGSLDALIGRLR  124 (205)
                      |-.|||+|.|||-|-
T Consensus       489 ~~~~G~~eRlia~Li  503 (614)
T PLN02837        489 RAILGSLERFFGVLI  503 (614)
T ss_pred             cCCccCHHHHHHHHH
Confidence            567999999887553


No 65 
>cd01355 AcnX Putative Aconitase X catalytic domain. Putative Aconitase X catalytic domain. It is predicted by comparative genomic analysis. The proteins are mainly found in archaea and proteobacteria. They are distantly related to Aconitase family of proteins by sequence similarity and seconary structure prediction. The functions have not yet been experimentally characterized. Thus, the prediction should be treated with caution.
Probab=24.43  E-value=75  Score=30.15  Aligned_cols=54  Identities=37%  Similarity=0.535  Sum_probs=35.1

Q ss_pred             chhHhHHHhhhcccC-cccccCCCCCCCCCCCCCCCCCCchhhhcchh--HH----HHHHHHHHHHHhCCCCC
Q 028699           70 GAHVLEFLRYLDQFG-KTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSL--DA----LIGRLRAAYEEHGGRPE  135 (205)
Q Consensus        70 g~hVleFLrylDqfG-KTkVH~~~C~ffG~p~ppapC~CPlRQAWGSL--DA----LIGRLRAafEE~Gg~pE  135 (205)
                      |..=++||..|.+.| |-+|+          ..-.|-.+.++  |..+  |.    .--||..||+++|..+.
T Consensus        48 G~agl~f~e~l~~~gakv~Vp----------TTlNp~~~D~~--w~~~gvd~~f~~~q~~i~~ay~~mG~~~t  108 (389)
T cd01355          48 GDAGLEFLERLADQGAKVAVP----------TTLNPISMDLH--WRELGVDEEFAEKQARLVKAYKAMGVDPT  108 (389)
T ss_pred             chhhHHHHHHHHhCCCeEeec----------CccCCcccCcc--hhhcCCCHHHHHHHHHHHHHHHHcCCccc
Confidence            344579998886666 34443          23456666777  8755  32    34477899999998865


No 66 
>PF01663 Phosphodiest:  Type I phosphodiesterase / nucleotide pyrophosphatase;  InterPro: IPR002591 This family consists of phosphodiesterases, including human plasma-cell membrane glycoprotein PC-1 / alkaline phosphodiesterase I / nucleotide pyrophosphatase (nppase). These enzymes catalyse the cleavage of phosphodiester and phosphosulphate bonds in NAD, deoxynucleotides and nucleotide sugars []. Another member of this family is ATX an autotaxin, tumor cell motility-stimulating protein which exhibits type I phosphodiesterases activity []. The alignment encompasses the active site [, ]. Also present within this family is 60 kDa Ca2+-ATPase from Myroides odoratus [].  This signature also hits a number of ethanolamine phosphate transferase involved in glycosylphosphatidylinositol-anchor biosynthesis.; GO: 0003824 catalytic activity; PDB: 2XRG_A 2XR9_A 3T02_A 3T01_A 3SZZ_A 3SZY_A 3T00_A 3NKM_A 3NKN_A 3NKR_A ....
Probab=24.38  E-value=59  Score=26.95  Aligned_cols=27  Identities=33%  Similarity=0.553  Sum_probs=23.3

Q ss_pred             hhhhcchhHHHHHHHHHHHHHhCCCCC
Q 028699          109 LRQAWGSLDALIGRLRAAYEEHGGRPE  135 (205)
Q Consensus       109 lRQAWGSLDALIGRLRAafEE~Gg~pE  135 (205)
                      .+++.-.+|..||+|.+++++.|...+
T Consensus       208 ~~~~~~~~D~~ig~l~~~l~~~~~~~~  234 (365)
T PF01663_consen  208 IEDAYRRIDQAIGRLLEALDENGLLED  234 (365)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHTT-TTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHhhCCCCc
Confidence            688999999999999999999976644


No 67 
>KOG1452 consensus Predicted Rho GTPase-activating protein [Signal transduction mechanisms]
Probab=24.09  E-value=40  Score=32.64  Aligned_cols=30  Identities=30%  Similarity=0.428  Sum_probs=22.7

Q ss_pred             HHHHHHHHhCCC--------CCCCcchhhHHHHHHHHHH
Q 028699          122 RLRAAYEEHGGR--------PEANPFGARAVRIFLREVR  152 (205)
Q Consensus       122 RLRAafEE~Gg~--------pE~NPF~araVRlYLReVR  152 (205)
                      -||++||-||+.        |+.|=. +..++.||||+=
T Consensus       233 mLR~~fe~n~r~~el~~E~iPD~nvI-tg~~kD~lrElp  270 (442)
T KOG1452|consen  233 MLRRDFEPNGRDFELGAESIPDYNVI-TGDSKDELRELP  270 (442)
T ss_pred             HHHHHhccCCcccccccccCCCccee-ecccHhHHHhCC
Confidence            589999999976        334433 458999999974


No 68 
>cd04379 RhoGAP_SYD1 RhoGAP_SYD1: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in SYD-1_like proteins. Syd-1, first identified and best studied in C.elegans, has been shown to play an important role in neuronal development by specifying axonal properties. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=24.05  E-value=95  Score=26.20  Aligned_cols=39  Identities=28%  Similarity=0.348  Sum_probs=26.6

Q ss_pred             chhHHHHHHHHHHHHHhCCCCCC------Ccc-hhhHHHHHHHHHHH
Q 028699          114 GSLDALIGRLRAAYEEHGGRPEA------NPF-GARAVRIFLREVRD  153 (205)
Q Consensus       114 GSLDALIGRLRAafEE~Gg~pE~------NPF-~araVRlYLReVRd  153 (205)
                      |+. +.|..||..|+..+...+-      ++. .|..++.||||.-+
T Consensus        44 Gs~-~~i~~L~~~~d~~~~~~~l~~~~~~dvh~vA~lLK~fLReLPe   89 (207)
T cd04379          44 GSA-AKKKELRDAFERNSAAVELSEELYPDINVITGVLKDYLRELPE   89 (207)
T ss_pred             CcH-HHHHHHHHHHcCCCCcCCCChhhcccHHHHHHHHHHHHHhCCC
Confidence            444 3599999999986543221      222 58899999999544


No 69 
>PF07700 HNOB:  Heme NO binding;  InterPro: IPR011644 This ligand-binding domain is found in soluble guanylate cyclases. In soluble guanylate cyclases this domain binds heme via a covalent linkage to histidine []. Soluble guanylate cyclases are nitric oxide-responsive signaling proteins.; GO: 0020037 heme binding; PDB: 3TFE_A 2O0C_B 3TFA_A 2O09_B 2O0G_B 3L6J_A 3TFG_B 3TF8_A 3TFF_A 3TF9_B ....
Probab=24.00  E-value=23  Score=28.34  Aligned_cols=36  Identities=22%  Similarity=0.314  Sum_probs=28.7

Q ss_pred             hhHHHHHHHHHh---cCCCCCCCCCcchhHhHHHhhhcc
Q 028699           47 RDWNTFCQYLRN---HRPPLSLPMCSGAHVLEFLRYLDQ   82 (205)
Q Consensus        47 rdWntf~qyL~n---~rPPlsL~~csg~hVleFLrylDq   82 (205)
                      ..|..|++|+-.   ..-|-.+.++.+.++.+||.-+|.
T Consensus        65 ~~l~~fG~~~~~~~~~~~~~~~l~~~g~~~~~FL~~ld~  103 (171)
T PF07700_consen   65 ELLEEFGEYFFDFLSESGYERLLRFLGRDLFDFLNNLDN  103 (171)
T ss_dssp             HHHHHHHHHHHHHHHHHCCHHHHHCTCSSHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhCcHHHHHhcCCCHHHHHHhHHH
Confidence            468888888876   445666778999999999998875


No 70 
>COG4865 Glutamate mutase epsilon subunit [Amino acid transport and metabolism]
Probab=23.70  E-value=51  Score=32.22  Aligned_cols=22  Identities=50%  Similarity=0.872  Sum_probs=16.8

Q ss_pred             HHHHHHHHHHHhCCCCCCCcch
Q 028699          119 LIGRLRAAYEEHGGRPEANPFG  140 (205)
Q Consensus       119 LIGRLRAafEE~Gg~pE~NPF~  140 (205)
                      +|.||.-+|||||.+=...||+
T Consensus       196 YVDRL~G~YeE~Gi~INREpFg  217 (485)
T COG4865         196 YVDRLMGMYEEHGIRINREPFG  217 (485)
T ss_pred             HHHHHHhHHHhcCeeeccccCC
Confidence            4566777999999887666665


No 71 
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain. ProRS is a homodimer. It is responsible for the attachment of proline to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of the enzyme bound aminoacyl-adenylate. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs in the core domain. This subfamily contains the core domain of ProRS from archaea, the cytoplasm of eukaryotes and some bacteria.
Probab=23.62  E-value=38  Score=28.98  Aligned_cols=17  Identities=29%  Similarity=0.603  Sum_probs=12.1

Q ss_pred             hhhhcchhHHHHHHHHH
Q 028699          109 LRQAWGSLDALIGRLRA  125 (205)
Q Consensus       109 lRQAWGSLDALIGRLRA  125 (205)
                      -+-.||+++.+||=|-+
T Consensus       244 h~~~~g~~~R~i~ali~  260 (261)
T cd00778         244 HQTSWGISTRLIGAIIM  260 (261)
T ss_pred             EEecccHHHHHHHHHHh
Confidence            44568988888886644


No 72 
>cd08782 Death_DAPK1 Death domain found in death-associated protein kinase 1. Death domain (DD) found in death-associated protein kinase 1 (DAPK1). DAPK1 is composed of several functional domains, including a kinase domain, a CaM regulatory domain, ankyrin repeats, a cytoskeletal binding domain and a C-terminal DD. It plays important roles in a diverse range of signal transduction pathways including apoptosis, growth factor signalling, and autophagy. Loss of DAPK1 expression, usually because of DNA methylation, is implicated in many tumor types. DAPK1 is highly abundant in the brain and has also been associated with neurodegeneration. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as ad
Probab=23.36  E-value=43  Score=24.95  Aligned_cols=28  Identities=29%  Similarity=0.420  Sum_probs=23.7

Q ss_pred             CCchhhhcchhH-HHHHHHHHHHHHhCCC
Q 028699          106 PCPLRQAWGSLD-ALIGRLRAAYEEHGGR  133 (205)
Q Consensus       106 ~CPlRQAWGSLD-ALIGRLRAafEE~Gg~  133 (205)
                      +|-+=+-|++-+ +-||.|..+.+|+|+.
T Consensus        47 T~~LL~~W~~~~~~tvg~L~~~L~~~gR~   75 (82)
T cd08782          47 TDALLQEWATAPPSTIGTLIDKLRELGRE   75 (82)
T ss_pred             HHHHHHHHhcCCcccHHHHHHHHHHcCcH
Confidence            455777899877 9999999999999974


No 73 
>PF10780 MRP_L53:  39S ribosomal protein L53/MRP-L53;  InterPro: IPR019716 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  Mitochondrial ribosomal protein L53 (also known as L44) is part of the 39S ribosome []. 
Probab=23.36  E-value=35  Score=23.68  Aligned_cols=25  Identities=48%  Similarity=0.794  Sum_probs=17.4

Q ss_pred             Ccc--hhhHHHHHHHHHHHHHHhhhCcc
Q 028699          137 NPF--GARAVRIFLREVRDFQAKARGVS  162 (205)
Q Consensus       137 NPF--~araVRlYLReVRd~QAkARgi~  162 (205)
                      |||  .++..|++|.-+ ..-+|++|+.
T Consensus         2 nPF~~~aksaR~FL~~i-p~s~k~~~tn   28 (51)
T PF10780_consen    2 NPFSPNAKSARLFLSLI-PPSAKARGTN   28 (51)
T ss_pred             CCCCcccHHHHHHHHhc-CCccccccCC
Confidence            788  467899999988 4445555543


No 74 
>cd04399 RhoGAP_fRGD2 RhoGAP_fRGD2: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of fungal RGD2-like proteins. Yeast Rgd2 is a GAP protein for Cdc42 and Rho5. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=23.18  E-value=93  Score=26.20  Aligned_cols=35  Identities=23%  Similarity=0.404  Sum_probs=25.4

Q ss_pred             HHHHHHHHHHHHhCCCCC--------CCc-chhhHHHHHHHHHHH
Q 028699          118 ALIGRLRAAYEEHGGRPE--------ANP-FGARAVRIFLREVRD  153 (205)
Q Consensus       118 ALIGRLRAafEE~Gg~pE--------~NP-F~araVRlYLReVRd  153 (205)
                      +-|-.||.+|++ |....        .++ -.+.++|+||||.-|
T Consensus        51 ~~i~~Lr~~~d~-~~~~~~~~~~~~~~dv~~va~~LK~ylReLPe   94 (212)
T cd04399          51 KETHQLRNLLNK-PKKPDKEVIILKKFEPSTVASVLKLYLLELPD   94 (212)
T ss_pred             HHHHHHHHHHcC-CCCcchhhhccccCCHHHHHHHHHHHHHHCCC
Confidence            568899999997 43332        223 378899999999765


No 75 
>cd08802 Death_UNC5B Death domain found in Uncoordinated-5B. Death Domain (DD) found in Uncoordinated-5B (UNC5B). UNC5B is part of the UNC-5 homolog family. It is a receptor for the secreted netrin-1 and plays a role in axonal guidance, angiogenesis, and apoptosis. UNC5B signaling is involved in the netrin-1-induced proliferation and migration of renal proximal tubular cells. It is also required for vascular patterning during embryonic development, and its activation inhibits sprouting angiogenesis. UNC5 proteins are transmembrane proteins with an extracellular domain consisting of two immunoglobulin repeats, two thrombospondin type-I modules and an intracellular region containing a ZU-5 domain, UPA domain and a DD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activatio
Probab=22.94  E-value=50  Score=25.27  Aligned_cols=17  Identities=35%  Similarity=0.438  Sum_probs=14.6

Q ss_pred             HHHHHHHHHHHHHhCCC
Q 028699          117 DALIGRLRAAYEEHGGR  133 (205)
Q Consensus       117 DALIGRLRAafEE~Gg~  133 (205)
                      |+-||+|.++++|+|+.
T Consensus        60 ~~~v~~L~~~L~~mgR~   76 (84)
T cd08802          60 DGDLNSLASALEEMGKS   76 (84)
T ss_pred             cccHHHHHHHHHHcCcc
Confidence            45689999999999975


No 76 
>cd04383 RhoGAP_srGAP RhoGAP_srGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in srGAPs. srGAPs are components of the intracellular part of Slit-Robo signalling pathway that is important for axon guidance and cell migration. srGAPs contain an N-terminal FCH domain, a central RhoGAP domain and a C-terminal SH3 domain; this SH3 domain interacts with the intracellular proline-rich-tail of the Roundabout receptor (Robo). This interaction with Robo then activates the rhoGAP domain which in turn inhibits Cdc42 activity. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific group
Probab=22.62  E-value=99  Score=25.36  Aligned_cols=35  Identities=20%  Similarity=0.515  Sum_probs=24.7

Q ss_pred             HHHHHHHHHHHHhCCCC---CCCc----chhhHHHHHHHHHHH
Q 028699          118 ALIGRLRAAYEEHGGRP---EANP----FGARAVRIFLREVRD  153 (205)
Q Consensus       118 ALIGRLRAafEE~Gg~p---E~NP----F~araVRlYLReVRd  153 (205)
                      .-|..||..|+. |..+   +.+.    -.|..++.||||..+
T Consensus        47 ~~i~~l~~~~d~-g~~~~~~~~~~~d~~~va~lLK~fLReLPe   88 (188)
T cd04383          47 VEVNDIKNAFER-GEDPLADDQNDHDINSVAGVLKLYFRGLEN   88 (188)
T ss_pred             HHHHHHHHHHhc-CCCccccccccccHHHHHHHHHHHHHhCCC
Confidence            578999999986 4333   1122    268999999999754


No 77 
>cd04377 RhoGAP_myosin_IX RhoGAP_myosin_IX: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in class IX myosins. Class IX myosins contain a characteristic head domain, a neck domain, a tail domain which contains a C6H2-zinc binding motif and a RhoGAP domain. Class IX myosins are single-headed, processive myosins that are partly cytoplasmic, and partly associated with membranes and the actin cytoskeleton. Class IX myosins are implicated in the regulation of neuronal morphogenesis and function of sensory systems, like the inner ear. There are two major isoforms, myosin IXA and IXB with several splice variants, which are both expressed in developing neurons. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell prolifer
Probab=22.50  E-value=2e+02  Score=23.32  Aligned_cols=61  Identities=16%  Similarity=0.205  Sum_probs=38.7

Q ss_pred             HhHHHhhhcccCcccccCCCCCCCCCCCCCCCCCCchhhhcchhHHHHHHHHHHHHHhCCC---CCCCcc-hhhHHHHHH
Q 028699           73 VLEFLRYLDQFGKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLDALIGRLRAAYEEHGGR---PEANPF-GARAVRIFL  148 (205)
Q Consensus        73 VleFLrylDqfGKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLDALIGRLRAafEE~Gg~---pE~NPF-~araVRlYL  148 (205)
                      |...+.|+++.|-+..+.    |+-               .|+ ..-|.+|+..|++....   -+.+|. .+..++.||
T Consensus        19 l~~~~~~l~~~g~~~eGi----FR~---------------~g~-~~~i~~l~~~l~~~~~~~~~~~~~~~~va~~LK~fl   78 (186)
T cd04377          19 LEKLLEHIEMHGLYTEGI----YRK---------------SGS-ANKIKELRQGLDTDPDSVNLEDYPIHVITSVLKQWL   78 (186)
T ss_pred             HHHHHHHHHHcCCCCCce----eeC---------------CCC-HHHHHHHHHHHhCCCcccCcccCCHHHHHHHHHHHH
Confidence            556678888888653322    222               133 35699999999874211   112444 789999999


Q ss_pred             HHHHH
Q 028699          149 REVRD  153 (205)
Q Consensus       149 ReVRd  153 (205)
                      |+.-+
T Consensus        79 r~Lpe   83 (186)
T cd04377          79 RELPE   83 (186)
T ss_pred             HcCCC
Confidence            98754


No 78 
>cd04390 RhoGAP_ARHGAP22_24_25 RhoGAP_ARHGAP22_24_25:  GTPase-activator protein (GAP) domain for Rho-like GTPases found in ARHGAP22, 24 and 25-like proteins; longer isoforms of these proteins contain an additional N-terminal pleckstrin homology (PH) domain. ARHGAP25 (KIA0053) has been identified as a GAP for Rac1 and Cdc42. Short isoforms (without the PH domain) of ARHGAP24, called RC-GAP72 and p73RhoGAP, and of ARHGAP22, called p68RacGAP, has been shown to be involved in angiogenesis and endothelial cell capillary formation. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the r
Probab=22.13  E-value=1.4e+02  Score=24.31  Aligned_cols=37  Identities=19%  Similarity=0.435  Sum_probs=26.3

Q ss_pred             HHHHHHHHHHHHHhCCC---CCCCcc-hhhHHHHHHHHHHH
Q 028699          117 DALIGRLRAAYEEHGGR---PEANPF-GARAVRIFLREVRD  153 (205)
Q Consensus       117 DALIGRLRAafEE~Gg~---pE~NPF-~araVRlYLReVRd  153 (205)
                      .+.|.+|+.+|+.....   .+.+|. .|..++.||||.-+
T Consensus        50 ~~~i~~l~~~~d~~~~~~~~~~~d~h~va~lLK~fLReLPe   90 (199)
T cd04390          50 ANLVKQLQDAFDAGERPSFDSDTDVHTVASLLKLYLRELPE   90 (199)
T ss_pred             HHHHHHHHHHHhCCCCCCccccCCHHHHHHHHHHHHHhCCC
Confidence            45789999999753321   234553 78899999998754


No 79 
>PF06480 FtsH_ext:  FtsH Extracellular;  InterPro: IPR011546 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This domain is found in the FtsH family of proteins that include FtsH a membrane-bound ATP-dependent protease universally conserved in prokaryotes []. The FtsH peptidases, which belong to MEROPS peptidase family M41 (clan MA(E)), efficiently degrade proteins that have a low thermodynamic stability - e.g. they lack robust unfoldase activity. This feature may be key and implies that this could be a criterion for degrading a protein. In Oenococcus oeni (Leuconostoc oenos) FtsH is involved in protection against environmental stress [], and shows increased expression under heat or osmotic stress. These two lines of evidence suggest that it is a fundamental prokaryotic self-protection mechanism that checks if proteins are correctly folded. The precise function of this N-terminal region is unclear. ; GO: 0004222 metalloendopeptidase activity, 0005524 ATP binding, 0008270 zinc ion binding, 0016021 integral to membrane; PDB: 2LNA_A.
Probab=22.13  E-value=1.1e+02  Score=21.05  Aligned_cols=26  Identities=31%  Similarity=0.257  Sum_probs=18.7

Q ss_pred             cchhHHHHHHHHHHHHHhCCCCCCCc
Q 028699          113 WGSLDALIGRLRAAYEEHGGRPEANP  138 (205)
Q Consensus       113 WGSLDALIGRLRAafEE~Gg~pE~NP  138 (205)
                      ++++|.+.-+|..+.+|+|..+++.|
T Consensus        84 ~~~~~~~~~~L~~~~~~~~v~~~~~~  109 (110)
T PF06480_consen   84 IPSVDSFDEFLIEALVEKGVKYESVP  109 (110)
T ss_dssp             -S-HHHHHHHHHHHHHHTT--TTT--
T ss_pred             CCCCHHHHHHHHHHHHHCCCccceec
Confidence            45699999999999999999988765


No 80 
>cd04436 DEP_fRgd2 DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in fungal RhoGAP (GTPase-activator protein) Rgd2-like proteins. Rgd2-like proteins share a common domain architecture, containing, beside the RhoGAP domain, a DEP and a FCH (Fes/CIP4 homology) domain. Yeast Rgd2 is a GAP protein for Cdc42 and Rho5.
Probab=21.93  E-value=57  Score=25.23  Aligned_cols=41  Identities=27%  Similarity=0.470  Sum_probs=29.6

Q ss_pred             HHHHHHHHhcCCCCCCCCC--cchhHh--HHHhhhcccCcccccC
Q 028699           50 NTFCQYLRNHRPPLSLPMC--SGAHVL--EFLRYLDQFGKTKVHN   90 (205)
Q Consensus        50 ntf~qyL~n~rPPlsL~~c--sg~hVl--eFLrylDqfGKTkVH~   90 (205)
                      .++++||..+++=.++..|  -|.|++  .|||+.+..|.|-++.
T Consensus        33 ~~Iv~~L~~n~~~~s~~~aE~fGQdLv~~gfir~~g~vG~~F~nS   77 (84)
T cd04436          33 SEIVSWLQENMPEKDLDAAEAFGQDLLNQGFLRLVGGVGSTFVNS   77 (84)
T ss_pred             HHHHHHHHHcCCCCCHHHHHHHHHHHHhCchHHHhcccCcceecC
Confidence            4688888888886666444  366664  4899999999876643


No 81 
>cd08799 Death_UNC5C Death domain found in Uncoordinated-5C. Death Domain (DD) found in Uncoordinated-5C (UNC5C). UNC5C is part of the UNC-5 homolog family. It is a receptor for the secreted netrin-1 and plays a role in axonal guidance, angiogenesis, and apoptosis. UNC5C plays a critical role in the development of spinal accesory motor neurons. Methylation of the UNC5C gene is associated with early stages of colorectal carcinogenesis. UNC5 proteins are transmembrane proteins with an extracellular domain consisting of two immunoglobulin repeats, two thrombospondin type-I modules and an intracellular region containing a ZU-5 domain, UPA domain and a DD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN.
Probab=21.91  E-value=48  Score=25.28  Aligned_cols=17  Identities=41%  Similarity=0.552  Sum_probs=14.9

Q ss_pred             HHHHHHHHHHHHHhCCC
Q 028699          117 DALIGRLRAAYEEHGGR  133 (205)
Q Consensus       117 DALIGRLRAafEE~Gg~  133 (205)
                      |+-||+|..+++|+|+.
T Consensus        60 ~~tv~~L~~~L~emgR~   76 (84)
T cd08799          60 DGNLSRLAAVLEEMGRH   76 (84)
T ss_pred             CCcHHHHHHHHHHcCCc
Confidence            56699999999999975


No 82 
>cd04384 RhoGAP_CdGAP RhoGAP_CdGAP: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of CdGAP-like proteins; CdGAP contains an N-terminal RhoGAP domain and a C-terminal proline-rich region, and it is active on both Cdc42 and Rac1 but not RhoA. CdGAP is recruited to focal adhesions via the interaction with the scaffold protein actopaxin (alpha-parvin). Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=21.87  E-value=1.4e+02  Score=24.71  Aligned_cols=38  Identities=21%  Similarity=0.460  Sum_probs=26.6

Q ss_pred             chhHHHHHHHHHHHHHhCCCCC-------CCcc-hhhHHHHHHHHHHH
Q 028699          114 GSLDALIGRLRAAYEEHGGRPE-------ANPF-GARAVRIFLREVRD  153 (205)
Q Consensus       114 GSLDALIGRLRAafEE~Gg~pE-------~NPF-~araVRlYLReVRd  153 (205)
                      |+. +-|.+||..|++.+ .++       .++. .|..++.||||.-|
T Consensus        43 G~~-~~i~~l~~~~d~~~-~~~~~~~~~~~d~h~va~lLK~flReLPe   88 (195)
T cd04384          43 GIA-SNIQRLRHEFDSEQ-IPDLTKDVYIQDIHSVSSLCKLYFRELPN   88 (195)
T ss_pred             CCH-HHHHHHHHHHcCCC-CCCcccccccccHHHHHHHHHHHHHhCCC
Confidence            454 56999999998643 332       2333 78889999999754


No 83 
>cd08177 MAR Maleylacetate reductase is involved in many aromatic compounds degradation pathways of aerobic microbes. Maleylacetate reductases (MAR) play an important role in the degradation of aromatic compounds  in aerobic microbes. In fungi and yeasts, the enzymes are involved in the catabolism of compounds such as phenol, tyrosine, benzoate, 4-hydroxybenzoate and resorcinol. In bacteria, the enzymes contribute to the degradation of resorcinol, 2,4-dihydroxybenzoate ([beta]-resorcylate) and 2,6-dihydroxybenzoate ([gamma]-resorcylate) via hydroxyquinol and maleylacetate. Maleylacetate reductases catalyze NADH- or NADPH-dependent reduction, at the carbon-carbon double bond, of maleylacetate or 2-chloromaleylacetate to 3-oxoadipate. In the case of 2-chloromaleylacetate, Maleylacetate reductases initially catalyses the NAD(P)H-dependent dechlorination to maleylacetate, which is then reduced to 3-oxoadipate. This enzyme is a homodimer. It is inhibited by thiol-blocking reagents such as p-
Probab=21.74  E-value=53  Score=28.94  Aligned_cols=93  Identities=16%  Similarity=0.206  Sum_probs=59.4

Q ss_pred             CCCCCCC-CCcchhHhHHHhhhcccCcccc-cCCCCCCCCCCCCCCCCCCchhhhc-chhHHHHHHHHHHHHHhCCCCCC
Q 028699           60 RPPLSLP-MCSGAHVLEFLRYLDQFGKTKV-HNQNCPFFGLPNPPAPCPCPLRQAW-GSLDALIGRLRAAYEEHGGRPEA  136 (205)
Q Consensus        60 rPPlsL~-~csg~hVleFLrylDqfGKTkV-H~~~C~ffG~p~ppapC~CPlRQAW-GSLDALIGRLRAafEE~Gg~pE~  136 (205)
                      .|-+.++ +++|..+-.|-.+.|...|..+ |....+...--.|-.--.+|.++.. +.+|||+--+-+.+.. ...|.+
T Consensus       102 ~p~i~IPTtatgse~t~~avit~~g~K~~i~~~~~~P~~~i~Dp~l~~~~P~~~~~~~g~Dal~h~iE~~~s~-~~~~~s  180 (337)
T cd08177         102 LPIIAIPTTLSGSEMTPIAGVTENGVKTTGRDPEVLPRTVIYDPELTLTTPRRLWLSSGIRAIDHAVEALYAP-DANPIV  180 (337)
T ss_pred             CCEEEEcCCchhhhhcCeEEEecCCceeEeeCccccCCEEEEChHHhcCCCHHHHHHHHHHHHHHHHHHHHcC-CCChHH
Confidence            4545554 3577778788777787545555 4344444444455666789999975 7899998777655433 234555


Q ss_pred             CcchhhHHHHHHHHHHH
Q 028699          137 NPFGARAVRIFLREVRD  153 (205)
Q Consensus       137 NPF~araVRlYLReVRd  153 (205)
                      .-|+-.++++-++..+.
T Consensus       181 ~~~a~~ai~~i~~~l~~  197 (337)
T cd08177         181 DLLAEEGIRALAEALPR  197 (337)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            55677788886665543


No 84 
>cd08800 Death_UNC5A Death domain found in Uncoordinated-5A. Death Domain (DD) found in Uncoordinated-5A (UNC5A). UNC5A is part of the UNC-5 homolog family. It is a receptor for the secreted netrin-1 and plays a critical role in neuronal development and differentiation, as well as axon-guidance. It also plays a role in regulating apoptosis in non-neuronal cells as a downstream target of p53. UNC5 proteins are transmembrane proteins with an extracellular domain consisting of two immunoglobulin repeats, two thrombospondin type-I modules and an intracellular region containing a ZU-5 domain, UPA domain and a DD. In general, DDs are protein-protein interaction domains found in a variety of domain architectures. Their common feature is that they form homodimers by self-association or heterodimers by associating with other members of the DD superfamily including CARD (Caspase activation and recruitment domain), DED (Death Effector Domain), and PYRIN. They serve as adaptors in signaling pathway
Probab=21.59  E-value=48  Score=25.59  Aligned_cols=17  Identities=24%  Similarity=0.347  Sum_probs=14.3

Q ss_pred             HHHHHHHHHHHHHhCCC
Q 028699          117 DALIGRLRAAYEEHGGR  133 (205)
Q Consensus       117 DALIGRLRAafEE~Gg~  133 (205)
                      |.-|+.|.++++|+|+.
T Consensus        60 ~g~l~~L~~~l~emGR~   76 (84)
T cd08800          60 NGNLNQLAAVVAEIGKQ   76 (84)
T ss_pred             CCcHHHHHHHHHHhCch
Confidence            44589999999999975


No 85 
>PF00618 RasGEF_N:  RasGEF N-terminal motif;  InterPro: IPR000651  The crystal structure of the guanine nucleotide exchange factor (GEF) region of human Sos1 complexes with Ras has been solved []. The structure consists of two distinct alpha helical structural domains: the N-terminal domain which seems to have a purely structural role and the C-terminal domain which is sufficient for catalytic activity and contains all residues that interact with Ras. A main feature of the catalytic domain is the protrusion of a helical hairpin important for the nucleotide-exchange mechanism. The N-terminal domain is likely to be important for the stability and correct placement of the hairpin structure.   This entry represents a domain found in several GEF for Ras-like small GTPases which lies N-terminal to the RasGef (Cdc25-like) domain. ; GO: 0005085 guanyl-nucleotide exchange factor activity, 0051056 regulation of small GTPase mediated signal transduction, 0005622 intracellular; PDB: 3CF6_E 2BYV_E 1NVW_S 1BKD_S 1XDV_A 2II0_A 1NVU_S 1NVX_S 1NVV_S 1XD4_B ....
Probab=21.57  E-value=55  Score=23.46  Aligned_cols=13  Identities=46%  Similarity=0.708  Sum_probs=8.0

Q ss_pred             cchhHHHHHHHHH
Q 028699          113 WGSLDALIGRLRA  125 (205)
Q Consensus       113 WGSLDALIGRLRA  125 (205)
                      .||||+||.+|=.
T Consensus         4 ~gtl~~Li~~L~~   16 (104)
T PF00618_consen    4 AGTLEKLIERLTS   16 (104)
T ss_dssp             EE-HHHHHHHHCH
T ss_pred             eeCHHHHHHHHhc
Confidence            4677777777754


No 86 
>PF12067 Sox_C_TAD:  Sox C-terminal transactivation domain;  InterPro: IPR021934 The Sox family of high mobility group (HMG) box transcription factors that are homologous to the Y-chromosome encoded sex- determining factor SRY plays important roles in embryonic development. Sox18, together with Sox7 and -17, constitutes the subgroup F within this family. Bioinformatic analysis of the C-termini of subgroup F Sox family members from different species including humans, mice, rat, chicken and Xenopus revealed three conserved blocks including highly conserved residues. They were termed proline, charged, and serine according to the predominance of the respective amino acids. The charged block comprises a strong transactivating domain []. This entry covers the entire Sox C-terminal domain, and was previously annotated as DUF3547.
Probab=21.54  E-value=50  Score=28.74  Aligned_cols=16  Identities=38%  Similarity=0.476  Sum_probs=11.9

Q ss_pred             hhhHHHHHHHHHhcCC
Q 028699           46 RRDWNTFCQYLRNHRP   61 (205)
Q Consensus        46 RrdWntf~qyL~n~rP   61 (205)
                      -=|.++|.|||...+.
T Consensus       140 eVDR~EFdQYLn~~~~  155 (197)
T PF12067_consen  140 EVDRTEFDQYLNSSRC  155 (197)
T ss_pred             hhhHHHHHHHhccccC
Confidence            3478999999986443


No 87 
>PF10774 DUF4226:  Domain of unknown function (DUF4226);  InterPro: IPR019710 This entry represents an uncharacterised family of proteins belonging to Mycobacteria. It was previously incorrectly annotated as Biofilm regulator BssS (also known as YliH). 
Probab=21.22  E-value=1.5e+02  Score=23.72  Aligned_cols=34  Identities=35%  Similarity=0.504  Sum_probs=29.5

Q ss_pred             hhHHHHHHHHHHHHHhCCCCCCCcchhhHHHHHHH
Q 028699          115 SLDALIGRLRAAYEEHGGRPEANPFGARAVRIFLR  149 (205)
Q Consensus       115 SLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLR  149 (205)
                      .||+||..++++....+. --.-|.|+|.+--||+
T Consensus        48 ~Ld~i~aeI~~Av~~~~~-aldTPaG~r~f~~fL~   81 (112)
T PF10774_consen   48 RLDAIQAEIEAAVAAQAP-ALDTPAGAREFQRFLR   81 (112)
T ss_pred             HHHHHHHHHHHHHHhccc-ccCCHHHHHHHHHHHH
Confidence            799999999999998886 4578999999888874


No 88 
>cd04406 RhoGAP_myosin_IXA RhoGAP_myosin_IXA: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain present in myosins IXA. Class IX myosins contain a characteristic head domain, a neck domain and a tail domain which contains a C6H2-zinc binding motif and a Rho-GAP domain. Class IX myosins are single-headed, processive myosins that are partly cytoplasmic, and partly associated with membranes and the actin cytoskeleton. Class IX myosins are implicated in the regulation of neuronal morphogenesis and function of sensory systems, like the inner ear. There are two major isoforms, myosin IXA and IXB with several splice variants, which are both expressed in developing neurons. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell prolife
Probab=20.75  E-value=1e+02  Score=25.31  Aligned_cols=36  Identities=19%  Similarity=0.265  Sum_probs=25.1

Q ss_pred             HHHHHHHHHHHHhCCCCC---CCcc-hhhHHHHHHHHHHH
Q 028699          118 ALIGRLRAAYEEHGGRPE---ANPF-GARAVRIFLREVRD  153 (205)
Q Consensus       118 ALIGRLRAafEE~Gg~pE---~NPF-~araVRlYLReVRd  153 (205)
                      ..|..|+..|+..+....   .++. .+..++.||||.-+
T Consensus        44 ~~i~~l~~~~d~~~~~~~~~~~d~h~va~lLK~fLReLPe   83 (186)
T cd04406          44 NKIKELRQGLDTDANSVNLDDYNIHVIASVFKQWLRDLPN   83 (186)
T ss_pred             HHHHHHHHHHccCCCCCCcccCCHHHHHHHHHHHHHhCCC
Confidence            458899999987543322   2333 78899999999744


No 89 
>PF02187 GAS2:  Growth-Arrest-Specific Protein 2 Domain;  InterPro: IPR003108 The growth-arrest-specific protein 2 domain is found associated with the spectrin repeat, calponin homology domain and EF hand in many proteins. It is found among others in the growth arrest-specific protein 2 [].; GO: 0007050 cell cycle arrest; PDB: 1V5R_A.
Probab=20.53  E-value=19  Score=27.15  Aligned_cols=13  Identities=46%  Similarity=1.158  Sum_probs=11.3

Q ss_pred             HHHHHHHHHhcCC
Q 028699           49 WNTFCQYLRNHRP   61 (205)
Q Consensus        49 Wntf~qyL~n~rP   61 (205)
                      |.||..||..|.|
T Consensus        56 W~tL~~~L~khDP   68 (73)
T PF02187_consen   56 WDTLEEYLDKHDP   68 (73)
T ss_dssp             EEEHHHHHHHH-H
T ss_pred             HHHHHHHhhccCC
Confidence            9999999999887


No 90 
>PRK13977 myosin-cross-reactive antigen; Provisional
Probab=20.51  E-value=1.1e+02  Score=30.54  Aligned_cols=100  Identities=16%  Similarity=0.135  Sum_probs=59.0

Q ss_pred             hHHHHHHHHHhcCCCCCCC-------CCcch-hHhHHHhhhccc--CcccccCCCCCCCCCCCCCCCCCCchhhhcchhH
Q 028699           48 DWNTFCQYLRNHRPPLSLP-------MCSGA-HVLEFLRYLDQF--GKTKVHNQNCPFFGLPNPPAPCPCPLRQAWGSLD  117 (205)
Q Consensus        48 dWntf~qyL~n~rPPlsL~-------~csg~-hVleFLrylDqf--GKTkVH~~~C~ffG~p~ppapC~CPlRQAWGSLD  117 (205)
                      |-.++.+|+..+....++.       -.-.. -..||++|+-+|  ---..+...|-.|...++              -|
T Consensus       161 d~~tI~d~f~~~Ff~t~Fw~~w~t~FaF~~whSA~E~rry~~rf~~~~~~l~~~s~l~ft~ynq--------------ye  226 (576)
T PRK13977        161 DDKTIEDWFSPEFFETNFWYYWRTMFAFEKWHSALEMRRYMHRFIHHIGGLPDLSGLKFTKYNQ--------------YE  226 (576)
T ss_pred             CCcCHHHHHhhcCchhHHHHHHHHHHCCchhhHHHHHHHHHHHHHHhhccCCccccccCCCCCc--------------hh
Confidence            3455666666655533321       01111 156788888777  233356666666665552              49


Q ss_pred             HHHHHHHHHHHHhCCCCCCCcchhhHHHHHHHHHHHHHHhhhCcchhh
Q 028699          118 ALIGRLRAAYEEHGGRPEANPFGARAVRIFLREVRDFQAKARGVSYDK  165 (205)
Q Consensus       118 ALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~QAkARgi~y~k  165 (205)
                      +||.-|+...+++|+.=..|   .++.+|. .+..+.+-++.||-+++
T Consensus       227 SLV~PL~~~Le~~GV~f~~~---t~VtdL~-~~~d~~~~~VtgI~~~~  270 (576)
T PRK13977        227 SLVLPLIKYLEDHGVDFQYG---TKVTDID-FDITGGKKTATAIHLTR  270 (576)
T ss_pred             HHHHHHHHHHHhCCCEEEeC---CEEEEEE-EcCCCCceEEEEEEEEe
Confidence            99999999999999874433   3333332 12223446788998865


No 91 
>PF12055 DUF3536:  Domain of unknown function (DUF3536);  InterPro: IPR021923  This presumed domain is functionally uncharacterised. This domain is found in bacteria and archaea. This domain is typically between 274 to 285 amino acids in length. This domain is found associated with PF03065 from PFAM. 
Probab=20.31  E-value=80  Score=28.96  Aligned_cols=42  Identities=38%  Similarity=0.632  Sum_probs=33.7

Q ss_pred             chhhhcchhHHHHHHHHHHHHHhCCCCCCCcchhhHHHHHHHHHHHH
Q 028699          108 PLRQAWGSLDALIGRLRAAYEEHGGRPEANPFGARAVRIFLREVRDF  154 (205)
Q Consensus       108 PlRQAWGSLDALIGRLRAafEE~Gg~pE~NPF~araVRlYLReVRd~  154 (205)
                      |||.   .||.|-.+|..+||+.|+.=-.+|..+|-  -|.+-|-+.
T Consensus         8 PLR~---Ald~Lrd~l~~~fe~~~~~l~~Dpw~ar~--~Yi~Vil~~   49 (285)
T PF12055_consen    8 PLRE---ALDWLRDRLDELFEEEGGELFKDPWAARD--EYIEVILDR   49 (285)
T ss_pred             HHHH---HHHHHHHHHHHHHHHHHHHhcCCHHHHHH--HHHHHHcCC
Confidence            5555   49999999999999999887788987764  777777554


Done!