Citrus Sinensis ID: 028712

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----

MSENAGGCCRCCCSFIFTLGLTSLFMWLSLRTSNPKCSIEGFYLPALDKSSNNRNNTTLQFQLKLENTNKDKGVYYDDVNVTVYDFPNRSHIIGTSVIGRFYQGHKKTAHKNGTAPTDQKVVSRAVFANGSAVFRVDLVTAVRFKIIAWKTKRHKIAVGADVEVNVNGTKVNKKNIKLSSSGSNNVSYYCCCVGILLYFFVLIFA

cccccccccHHHHHHHHHHHHHHHEEEEEECccccEEEEEEEEEEECcccccccccEEEEEEEEEEccccCEEEEEEEEEEEEEEccccEEEEEEEEccccCCccccCEEEEEEEEcccHHHHHHHHHcccEEEEEEEEEEEEEEEEEEEEcEEEEEEEEEEEEcccccccccccCECcccccccCEEEEEEEEEEEEEEEEEcc

*****GG*CRCCCSFIFTLGLTSLFMWLSLRTSNPKCSIEGFYLPALDKSSNNRNNTTLQFQLKLENTNKDKGVYYDDVNVTVYDFPNRSHIIGTSVIGRFYQGHKKTAHKNGTAPTDQKVVSRAVFANGSAVFRVDLVTAVRFKIIAWKTKRHKIAVGADVEVNVNGTKVNKKNIKL***GSNNVSYYCCCVGILLYFFVLIFA

xxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein NDR1	Involved in disease resistance. Required for resistance conferred by multiple R genes recognizing different bacterial and oomycete pathogen isolates like avirulent P.syringae or H.parasitica (downy mildew). Required for the establishment of hypersensitive response (HR) and systemic acquired resistance (SAR) after infection with the bacterial pathogen P.syringae DC3000 carrying avrRpt2. Required for resistance to the soilborne fungus V.longisporum. Interaction with RIN4 is required for the activation of the R gene RPS2 and RPS2-mediated resistance.	probable	O48915

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1XO8, chain A
Confidence level:probable
Coverage over the Query: 33-141
View the alignment between query and template
View the model in PyMOL