Query         028717
Match_columns 205
No_of_seqs    184 out of 581
Neff          6.5 
Searched_HMMs 46136
Date          Fri Mar 29 15:54:08 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028717.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028717hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03097 FHY3 Protein FAR-RED  100.0 3.2E-35 6.9E-40  286.4  16.2  123    4-126    57-192 (846)
  2 PF03101 FAR1:  FAR1 DNA-bindin 100.0 1.3E-28 2.8E-33  180.2   8.6   90   35-124     1-91  (91)
  3 PF08731 AFT:  Transcription fa  99.1   8E-10 1.7E-14   84.0   9.6   89   27-122     1-111 (111)
  4 PF03108 DBD_Tnp_Mut:  MuDR fam  98.2 1.1E-05 2.5E-10   55.7   7.9   62   22-111     5-67  (67)
  5 PF04500 FLYWCH:  FLYWCH zinc f  91.2    0.49 1.1E-05   30.9   4.4   25   93-120    38-62  (62)
  6 PF03106 WRKY:  WRKY DNA -bindi  90.6     1.8 3.9E-05   29.4   6.8   28   94-121    31-59  (60)
  7 COG5470 Uncharacterized conser  85.8    0.46   1E-05   35.4   1.5   45    7-51     40-84  (96)
  8 PF04800 ETC_C1_NDUFA4:  ETC co  64.7     6.1 0.00013   29.7   2.5   28   22-53     50-77  (101)
  9 smart00774 WRKY DNA binding do  63.8      10 0.00022   25.8   3.2   28   93-120    31-59  (59)
 10 smart00461 WH1 WASP homology r  63.2     4.8  0.0001   30.2   1.7   20   22-41     84-103 (106)
 11 cd00837 EVH1 EVH1 (Enabled, Va  61.7     5.4 0.00012   29.7   1.7   20   22-41     82-101 (104)
 12 PF07576 BRAP2:  BRCA1-associat  59.3     7.5 0.00016   29.6   2.1   19   24-42     58-76  (110)
 13 cd01205 WASP WASP-type EVH1 do  58.2       7 0.00015   29.6   1.8   28   11-41     75-102 (105)
 14 PF00568 WH1:  WH1 domain;  Int  58.0     7.2 0.00016   29.3   1.8   20   22-41     89-108 (111)
 15 PF07045 DUF1330:  Protein of u  52.9     6.8 0.00015   26.5   0.9   31    9-39     28-58  (65)
 16 PF04684 BAF1_ABF1:  BAF1 / ABF  52.6      31 0.00068   32.7   5.4   44   24-73     25-68  (496)
 17 PF15299 ALS2CR8:  Amyotrophic   51.5      12 0.00026   31.8   2.3   19   84-102    69-87  (225)
 18 PF08222 HTH_CodY:  CodY helix-  43.8      11 0.00024   25.7   0.8   19  180-198    13-31  (61)
 19 KOG3671 Actin regulatory prote  42.9      20 0.00044   34.3   2.6   42    8-52    106-147 (569)
 20 cd01207 Ena-Vasp Enabled-VASP-  39.8      19 0.00042   27.5   1.7   19   22-40     85-103 (111)
 21 PF12441 DUF3680:  Protein of u  38.9      24 0.00052   22.3   1.7   14   26-39      7-20  (42)
 22 PF08672 APC2:  Anaphase promot  37.6      73  0.0016   21.5   4.1   40  161-200    11-50  (60)
 23 PF01693 Cauli_VI:  Caulimoviru  36.7      26 0.00057   21.9   1.7   13   24-36     32-44  (44)
 24 PF08471 Ribonuc_red_2_N:  Clas  32.3      38 0.00083   25.1   2.2   17   26-42     72-88  (93)
 25 PF04684 BAF1_ABF1:  BAF1 / ABF  30.8      31 0.00067   32.7   1.8   22  106-127   164-185 (496)
 26 PF08414 NADPH_Ox:  Respiratory  23.8      63  0.0014   24.3   2.0   25   22-47     53-77  (100)
 27 PF11132 SplA:  Transcriptional  23.2      62  0.0013   23.0   1.8   16   25-40     58-73  (75)
 28 PF03462 PCRF:  PCRF domain;  I  21.0   3E+02  0.0066   20.6   5.4   25   31-55     66-90  (115)

No 1  
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=100.00  E-value=3.2e-35  Score=286.40  Aligned_cols=123  Identities=34%  Similarity=0.582  Sum_probs=106.2

Q ss_pred             cccccccccccCCCCCCCccCCeeCCHHHHHHHHHHHhhhcCcEEEEcceeeccCCcceEEEEEEecccCccccCCCC--
Q 028717            4 NVNDQEMAVTKGSSDGEPYLGMEFESEEAAKVFYDAYATHMGFIMRVDAFRRSMRDGKVVWRRLVCNKEGFRKLRPRR--   81 (205)
Q Consensus         4 ~~~~~~~~~~e~~~~~~P~~Gm~F~S~eeA~~FY~~YA~~~GF~ir~~~s~rs~~~g~i~~~~fvCsreG~~~~~~~~--   81 (205)
                      ++.+.+.++.+.++..+|++||+|+|+||||+||+.||+++||+||+.+++|++.+|.|++++|+|+|+|+++.+.+.  
T Consensus        57 ~~~~~~~~~~~~~~~~~P~vGMeF~S~eeA~~FYn~YA~~~GFsVRi~~srrsk~~~~ii~r~fvCsreG~~~~~~~~~~  136 (846)
T PLN03097         57 NSPTGELVEFKEDTNLEPLSGMEFESHGEAYSFYQEYARSMGFNTAIQNSRRSKTSREFIDAKFACSRYGTKREYDKSFN  136 (846)
T ss_pred             cccccccccccCCCCccCcCCCeECCHHHHHHHHHHHHhhcCceEEeeceeccCCCCcEEEEEEEEcCCCCCcccccccc
Confidence            344566677888999999999999999999999999999999999999999999999999999999999996432110  


Q ss_pred             -----------CCCCCCCcccccCCccEEEEEEecCCcEEEEEEeecCCcccccCC
Q 028717           82 -----------SENRKPRAVTREGCKAMIVVKKEKTGKWVVTRFVKEHNHPLVAIP  126 (205)
Q Consensus        82 -----------~~~~r~r~~tRtgC~A~m~vk~~~~gkW~V~~~~~eHNH~L~~~~  126 (205)
                                 ...+++|+.+||||+|+|+|++.++|+|+|++|++||||||.|+.
T Consensus       137 ~~~~~~~k~~~~~~~~rR~~tRtGC~A~m~Vk~~~~gkW~V~~fv~eHNH~L~p~~  192 (846)
T PLN03097        137 RPRARQTKQDPENGTGRRSCAKTDCKASMHVKRRPDGKWVIHSFVKEHNHELLPAQ  192 (846)
T ss_pred             cccccccccCcccccccccccCCCCceEEEEEEcCCCeEEEEEEecCCCCCCCCcc
Confidence                       011235778999999999999988899999999999999999764


No 2  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=99.95  E-value=1.3e-28  Score=180.23  Aligned_cols=90  Identities=41%  Similarity=0.757  Sum_probs=82.0

Q ss_pred             HHHHHHhhhcCcEEEEcceeeccCCcceEEEEEEecccCccccCCCC-CCCCCCCcccccCCccEEEEEEecCCcEEEEE
Q 028717           35 VFYDAYATHMGFIMRVDAFRRSMRDGKVVWRRLVCNKEGFRKLRPRR-SENRKPRAVTREGCKAMIVVKKEKTGKWVVTR  113 (205)
Q Consensus        35 ~FY~~YA~~~GF~ir~~~s~rs~~~g~i~~~~fvCsreG~~~~~~~~-~~~~r~r~~tRtgC~A~m~vk~~~~gkW~V~~  113 (205)
                      +||+.||..+||+||+.++++++.+|.+++..|+|+++|+++.+... ...+++++++||||||+|.|++..+|.|.|+.
T Consensus         1 ~fy~~yA~~~GF~vr~~~s~~~~~~~~~~~~~~~C~r~G~~~~~~~~~~~~~r~~~s~ktgC~a~i~v~~~~~~~w~v~~   80 (91)
T PF03101_consen    1 DFYNSYARRHGFSVRKSSSRKSKKNGEIKRVTFVCSRGGKYKSKKKNEEKRRRNRPSKKTGCKARINVKRRKDGKWRVTS   80 (91)
T ss_pred             CHHHHhcCcCCeEEEEeeeEeCCCCceEEEEEEEECCcccccccccccccccccccccccCCCEEEEEEEccCCEEEEEE
Confidence            59999999999999999999988899999999999999997665443 45678899999999999999998789999999


Q ss_pred             EeecCCccccc
Q 028717          114 FVKEHNHPLVA  124 (205)
Q Consensus       114 ~~~eHNH~L~~  124 (205)
                      |+++|||||+|
T Consensus        81 ~~~~HNH~L~P   91 (91)
T PF03101_consen   81 FVLEHNHPLCP   91 (91)
T ss_pred             CcCCcCCCCCC
Confidence            99999999986


No 3  
>PF08731 AFT:  Transcription factor AFT;  InterPro: IPR014842 AFT (activator of iron transcription) is an iron regulated transcriptional activator that regulates the expression of genes involved in iron homeostasis. This entry includes the paralogous pair of transcription factors AFT1 and AFT2. 
Probab=99.10  E-value=8e-10  Score=84.00  Aligned_cols=89  Identities=19%  Similarity=0.367  Sum_probs=69.2

Q ss_pred             eCCHHHHHHHHHHHhhhcCcEEEEcceeeccCCcceEEEEEEecccCccccCCCC--------------------CCCCC
Q 028717           27 FESEEAAKVFYDAYATHMGFIMRVDAFRRSMRDGKVVWRRLVCNKEGFRKLRPRR--------------------SENRK   86 (205)
Q Consensus        27 F~S~eeA~~FY~~YA~~~GF~ir~~~s~rs~~~g~i~~~~fvCsreG~~~~~~~~--------------------~~~~r   86 (205)
                      |++.+|...|....++..||+|++.+|..+       ...|.|--.|..+.....                    ...+.
T Consensus         1 F~~k~~ikpwlq~~~~~~Gi~iVIerSd~~-------ki~FkCk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~   73 (111)
T PF08731_consen    1 FDDKDEIKPWLQKIFYPQGIGIVIERSDKK-------KIVFKCKNGKRYRHKKKKKGQAQAQQKESTSGNKNKSSKKKKK   73 (111)
T ss_pred             CCchHHHHHHHHHHhhhcCceEEEEecCCc-------eEEEEEecCCCcccccccccccccccccccccccccccccccC
Confidence            889999999999999999999999988653       347999887774332110                    11122


Q ss_pred             CC-cccccCCccEEEEEEe-cCCcEEEEEEeecCCccc
Q 028717           87 PR-AVTREGCKAMIVVKKE-KTGKWVVTRFVKEHNHPL  122 (205)
Q Consensus        87 ~r-~~tRtgC~A~m~vk~~-~~gkW~V~~~~~eHNH~L  122 (205)
                      ++ .+..++||++|+-... ...+|.|..+..+|||||
T Consensus        74 k~t~srk~~CPFriRA~yS~k~k~W~lvvvnn~HnH~l  111 (111)
T PF08731_consen   74 KRTKSRKNTCPFRIRANYSKKNKKWTLVVVNNEHNHPL  111 (111)
T ss_pred             CcccccccCCCeEEEEEEEecCCeEEEEEecCCcCCCC
Confidence            33 4556999999998876 579999999999999997


No 4  
>PF03108 DBD_Tnp_Mut:  MuDR family transposase;  InterPro: IPR004332 The plant MuDR transposase domain is present in plant proteins that are presumed to be the transposases for Mutator transposable elements [, ]. The function of these proteins is unknown. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=98.19  E-value=1.1e-05  Score=55.66  Aligned_cols=62  Identities=26%  Similarity=0.416  Sum_probs=52.2

Q ss_pred             ccCCeeCCHHHHHHHHHHHhhhcCcEEEEcceeeccCCcceEEEEEEecccCccccCCCCCCCCCCCcccccCCccEEEE
Q 028717           22 YLGMEFESEEAAKVFYDAYATHMGFIMRVDAFRRSMRDGKVVWRRLVCNKEGFRKLRPRRSENRKPRAVTREGCKAMIVV  101 (205)
Q Consensus        22 ~~Gm~F~S~eeA~~FY~~YA~~~GF~ir~~~s~rs~~~g~i~~~~fvCsreG~~~~~~~~~~~~r~r~~tRtgC~A~m~v  101 (205)
                      .+||.|+|.+|+......||-..||.++..++.+       .+..++|.  +                   .|||++|..
T Consensus         5 ~~G~~F~~~~e~k~av~~yai~~~~~~~v~ksd~-------~r~~~~C~--~-------------------~~C~Wrv~a   56 (67)
T PF03108_consen    5 EVGQTFPSKEEFKEAVREYAIKNGFEFKVKKSDK-------KRYRAKCK--D-------------------KGCPWRVRA   56 (67)
T ss_pred             ccCCEECCHHHHHHHHHHHHHhcCcEEEEeccCC-------EEEEEEEc--C-------------------CCCCEEEEE
Confidence            5799999999999999999999999999987643       36778886  1                   369999999


Q ss_pred             EEec-CCcEEE
Q 028717          102 KKEK-TGKWVV  111 (205)
Q Consensus       102 k~~~-~gkW~V  111 (205)
                      ...+ ++.|.|
T Consensus        57 s~~~~~~~~~I   67 (67)
T PF03108_consen   57 SKRKRSDTFQI   67 (67)
T ss_pred             EEcCCCCEEEC
Confidence            8874 578876


No 5  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=91.17  E-value=0.49  Score=30.94  Aligned_cols=25  Identities=40%  Similarity=0.694  Sum_probs=10.7

Q ss_pred             cCCccEEEEEEecCCcEEEEEEeecCCc
Q 028717           93 EGCKAMIVVKKEKTGKWVVTRFVKEHNH  120 (205)
Q Consensus        93 tgC~A~m~vk~~~~gkW~V~~~~~eHNH  120 (205)
                      .+|+|++.+.   ++.-.|.....+|||
T Consensus        38 ~~C~a~~~~~---~~~~~~~~~~~~HnH   62 (62)
T PF04500_consen   38 HGCRARLITD---AGDGRVVRTNGEHNH   62 (62)
T ss_dssp             S----EEEEE-----TTEEEE-S---SS
T ss_pred             CCCeEEEEEE---CCCCEEEECCCccCC
Confidence            6899999987   233345556689999


No 6  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=90.57  E-value=1.8  Score=29.41  Aligned_cols=28  Identities=36%  Similarity=0.656  Sum_probs=21.6

Q ss_pred             CCccEEEEEEec-CCcEEEEEEeecCCcc
Q 028717           94 GCKAMIVVKKEK-TGKWVVTRFVKEHNHP  121 (205)
Q Consensus        94 gC~A~m~vk~~~-~gkW~V~~~~~eHNH~  121 (205)
                      ||+|.=.|.+.. ++.-+++...-+||||
T Consensus        31 ~C~akK~Vqr~~~d~~~~~vtY~G~H~h~   59 (60)
T PF03106_consen   31 GCPAKKQVQRSADDPNIVIVTYEGEHNHP   59 (60)
T ss_dssp             TEEEEEEEEEETTCCCEEEEEEES--SS-
T ss_pred             ChhheeeEEEecCCCCEEEEEEeeeeCCC
Confidence            899998888763 7788899999999997


No 7  
>COG5470 Uncharacterized conserved protein [Function unknown]
Probab=85.80  E-value=0.46  Score=35.41  Aligned_cols=45  Identities=22%  Similarity=0.229  Sum_probs=34.5

Q ss_pred             ccccccccCCCCCCCccCCeeCCHHHHHHHHHHHhhhcCcEEEEc
Q 028717            7 DQEMAVTKGSSDGEPYLGMEFESEEAAKVFYDAYATHMGFIMRVD   51 (205)
Q Consensus         7 ~~~~~~~e~~~~~~P~~Gm~F~S~eeA~~FY~~YA~~~GF~ir~~   51 (205)
                      |++..+.|++-.-.+.+=++|+|.+.|++|||+=+...=-++|..
T Consensus        40 GG~v~~lEG~w~ptr~vviEFps~~~ar~~y~SpeYq~a~~~Rq~   84 (96)
T COG5470          40 GGEVETLEGEWRPTRNVVIEFPSLEAARDCYNSPEYQAAAAIRQA   84 (96)
T ss_pred             CCCeeeccCCCCcccEEEEEcCCHHHHHHHhcCHHHHHHHHHHhh
Confidence            455677788877678888999999999999998666655555443


No 8  
>PF04800 ETC_C1_NDUFA4:  ETC complex I subunit conserved region;  InterPro: IPR006885 This entry represents prokaryotic NADH-ubiquinone oxidoreductase subunits (1.6.5.3 from EC, 1.6.99.3 from EC) from complex I of the electron transport chain initially identified in Neurospora crassa as a 21 kDa protein [].; GO: 0016651 oxidoreductase activity, acting on NADH or NADPH, 0022900 electron transport chain, 0005743 mitochondrial inner membrane; PDB: 2JYA_A 2LJU_A.
Probab=64.69  E-value=6.1  Score=29.73  Aligned_cols=28  Identities=29%  Similarity=0.443  Sum_probs=21.1

Q ss_pred             ccCCeeCCHHHHHHHHHHHhhhcCcEEEEcce
Q 028717           22 YLGMEFESEEAAKVFYDAYATHMGFIMRVDAF   53 (205)
Q Consensus        22 ~~Gm~F~S~eeA~~FY~~YA~~~GF~ir~~~s   53 (205)
                      .+.|.|+|.|+|..    ||.+.|....+..-
T Consensus        50 ~v~l~F~skE~Ai~----yaer~G~~Y~V~~p   77 (101)
T PF04800_consen   50 SVRLKFDSKEDAIA----YAERNGWDYEVEEP   77 (101)
T ss_dssp             -CEEEESSHHHHHH----HHHHCT-EEEEE-S
T ss_pred             eeEeeeCCHHHHHH----HHHHcCCeEEEeCC
Confidence            36789999999987    68888888877643


No 9  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=63.79  E-value=10  Score=25.79  Aligned_cols=28  Identities=29%  Similarity=0.481  Sum_probs=22.6

Q ss_pred             cCCccEEEEEEe-cCCcEEEEEEeecCCc
Q 028717           93 EGCKAMIVVKKE-KTGKWVVTRFVKEHNH  120 (205)
Q Consensus        93 tgC~A~m~vk~~-~~gkW~V~~~~~eHNH  120 (205)
                      .||+|+=.|... +++.-.++-..-+|||
T Consensus        31 ~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774       31 QGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            589998777666 4677888888999998


No 10 
>smart00461 WH1 WASP homology region 1. Region of the Wiskott-Aldrich syndrome protein (WASp) that contains point mutations in the majority of patients with WAS. Unknown function. Ena-like WH1 domains bind polyproline-containing peptides, and that Homer contains a WH1 domain.
Probab=63.18  E-value=4.8  Score=30.17  Aligned_cols=20  Identities=40%  Similarity=0.542  Sum_probs=17.5

Q ss_pred             ccCCeeCCHHHHHHHHHHHh
Q 028717           22 YLGMEFESEEAAKVFYDAYA   41 (205)
Q Consensus        22 ~~Gm~F~S~eeA~~FY~~YA   41 (205)
                      .+|..|.|++||..|++.-.
T Consensus        84 ~~GLnF~se~EA~~F~~~v~  103 (106)
T smart00461       84 VYGLNFASEEEAKKFRKKVL  103 (106)
T ss_pred             EEEeecCCHHHHHHHHHHHH
Confidence            47999999999999998654


No 11 
>cd00837 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain. EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain. The EVH1 domain binds to other proteins at proline rich sequences in either FPPPP or PPXXF motifs. It is found in the cytoskeletal reorganization proteins Enabled VASP, and WASP, and in the synaptic scaffolding protein Homer. It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=61.69  E-value=5.4  Score=29.72  Aligned_cols=20  Identities=35%  Similarity=0.486  Sum_probs=17.6

Q ss_pred             ccCCeeCCHHHHHHHHHHHh
Q 028717           22 YLGMEFESEEAAKVFYDAYA   41 (205)
Q Consensus        22 ~~Gm~F~S~eeA~~FY~~YA   41 (205)
                      .+|..|.|++||.+|++.-.
T Consensus        82 ~~GL~F~se~eA~~F~~~v~  101 (104)
T cd00837          82 VYGLNFASEEEAAQFRKKVL  101 (104)
T ss_pred             EEEEeeCCHHHHHHHHHHHH
Confidence            68999999999999998643


No 12 
>PF07576 BRAP2:  BRCA1-associated protein 2;  InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening []. These proteins share a region of sequence similarity at their N terminus. They also have IPR001607 from INTERPRO at the C terminus.
Probab=59.31  E-value=7.5  Score=29.61  Aligned_cols=19  Identities=26%  Similarity=0.628  Sum_probs=16.9

Q ss_pred             CCeeCCHHHHHHHHHHHhh
Q 028717           24 GMEFESEEAAKVFYDAYAT   42 (205)
Q Consensus        24 Gm~F~S~eeA~~FY~~YA~   42 (205)
                      =|.|.+.+.|.+||..|-.
T Consensus        58 LikF~~~~~Ad~Fy~~fNG   76 (110)
T PF07576_consen   58 LIKFRDQESADEFYEEFNG   76 (110)
T ss_pred             EEEECCHHHHHHHHHHhCC
Confidence            3699999999999999964


No 13 
>cd01205 WASP WASP-type EVH1 domain. WASP-type EVH1 domain.  Wiskott-Aldrich syndrome (WAS) is an X-linked recessive disease, characterized by eczema, immunodeficiency, and thrombocytopenia. The majority of patients with WAS, or a milder version of the disorder,  X-linked thrombocytopenia (XLT), have point mutations in the EVH1 domain of WASP (Wiskott-Aldrich syndrome protein).  WASP  is an actin regulatory protein consisting of an N-terminal EVH1 domain, a basic region, a GTP binding domain, a proline rich region and a WH2 acidic region.  Yeast members lack the GTP binding domain. WASP binds a 25 residue proline rich motif from the WASP Interacting Protein (WIP) via its N-terminal EVH1 domain.
Probab=58.16  E-value=7  Score=29.62  Aligned_cols=28  Identities=21%  Similarity=0.358  Sum_probs=21.4

Q ss_pred             ccccCCCCCCCccCCeeCCHHHHHHHHHHHh
Q 028717           11 AVTKGSSDGEPYLGMEFESEEAAKVFYDAYA   41 (205)
Q Consensus        11 ~~~e~~~~~~P~~Gm~F~S~eeA~~FY~~YA   41 (205)
                      .+++.|   .=.+|..|.+++||..||+.-.
T Consensus        75 htFe~d---~c~~GL~Fade~EA~~F~k~v~  102 (105)
T cd01205          75 HTFEGD---DCVVGLNFADETEAAEFRKKVL  102 (105)
T ss_pred             EEEecc---CcEEEEEECCHHHHHHHHHHHH
Confidence            445555   3457999999999999998643


No 14 
>PF00568 WH1:  WH1 domain;  InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events. This domain of around 115 amino acids is present in species ranging from yeast to mammals. Many EVH1-containing proteins associate with actin-based structures and play a role in cytoskeletal organisation. EVH1 domains recognise and bind the proline-rich motif FPPPP with low-affinity, further interactions then form between flanking residues [][].  WASP family proteins contain a EVH1 (WH1) in their N-terminals which bind proline-rich sequences in the WASP interacting protein. Proteins of the RanBP1 family contain a WH1 domain in their N-terminal region, which seems to bind a different sequence motif present in the C-terminal part of RanGTP protein [,].  Tertiary structure of the WH1 domain of the Mena protein revealed structure similarities with the pleckstrin homology (PH) domain. The overall fold consists of a compact parallel beta-sandwich, closed along one edge by a long alpha-helix. A highly conserved cluster of three surface-exposed aromatic side-chains forms the recognition site for the molecules target ligands. [].; GO: 0005515 protein binding; PDB: 1I2H_A 1DDV_A 1DDW_A 1EGX_A 3SYX_A 1TJ6_B 1XOD_B 1EVH_A 1I7A_B 2JP2_A ....
Probab=58.02  E-value=7.2  Score=29.27  Aligned_cols=20  Identities=40%  Similarity=0.677  Sum_probs=17.9

Q ss_pred             ccCCeeCCHHHHHHHHHHHh
Q 028717           22 YLGMEFESEEAAKVFYDAYA   41 (205)
Q Consensus        22 ~~Gm~F~S~eeA~~FY~~YA   41 (205)
                      ..|..|.|++||..|++.--
T Consensus        89 ~~GLnF~se~eA~~F~~~v~  108 (111)
T PF00568_consen   89 VYGLNFASEEEADQFYKKVQ  108 (111)
T ss_dssp             EEEEEESSHHHHHHHHHHHH
T ss_pred             EEEEecCCHHHHHHHHHHHh
Confidence            78999999999999998653


No 15 
>PF07045 DUF1330:  Protein of unknown function (DUF1330);  InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.; PDB: 2FIU_B 3HHL_A 3DCA_D 3LO3_I.
Probab=52.94  E-value=6.8  Score=26.50  Aligned_cols=31  Identities=39%  Similarity=0.523  Sum_probs=20.8

Q ss_pred             ccccccCCCCCCCccCCeeCCHHHHHHHHHH
Q 028717            9 EMAVTKGSSDGEPYLGMEFESEEAAKVFYDA   39 (205)
Q Consensus         9 ~~~~~e~~~~~~P~~Gm~F~S~eeA~~FY~~   39 (205)
                      .....|++....-.+=.+|+|.++|..||+.
T Consensus        28 ~~~~leG~~~~~~~viieFPs~~aa~~~~~s   58 (65)
T PF07045_consen   28 EPEVLEGDWDPDRVVIIEFPSMEAAKAWYNS   58 (65)
T ss_dssp             EEEEEEST-SSSEEEEEEESSHHHHHHHHCS
T ss_pred             ceeEEecCCCCCeEEEEECCCHHHHHHHHCC
Confidence            3345555333333445799999999999985


No 16 
>PF04684 BAF1_ABF1:  BAF1 / ABF1 chromatin reorganising factor;  InterPro: IPR006774 ABF1 is a sequence-specific DNA binding protein involved in transcription activation, gene silencing and initiation of DNA replication. ABF1 is known to remodel chromatin, and it is proposed that it mediates its effects on transcription and gene expression by modifying local chromatin architecture []. These functions require a conserved stretch of 20 amino acids in the C-terminal region of ABF1 (amino acids 639 to 662 Saccharomyces cerevisiae (P14164 from SWISSPROT)) []. The N-terminal two thirds of the protein are necessary for DNA binding, and the N terminus (amino acids 9 to 91 in S. cerevisiae) is thought to contain a novel zinc-finger motif which may stabilise the protein structure [].; GO: 0003677 DNA binding, 0006338 chromatin remodeling, 0005634 nucleus
Probab=52.61  E-value=31  Score=32.71  Aligned_cols=44  Identities=14%  Similarity=0.152  Sum_probs=37.1

Q ss_pred             CCeeCCHHHHHHHHHHHhhhcCcEEEEcceeeccCCcceEEEEEEecccC
Q 028717           24 GMEFESEEAAKVFYDAYATHMGFIMRVDAFRRSMRDGKVVWRRLVCNKEG   73 (205)
Q Consensus        24 Gm~F~S~eeA~~FY~~YA~~~GF~ir~~~s~rs~~~g~i~~~~fvCsreG   73 (205)
                      +..|+|.++=|.-.|.|-...---|....|.|++      -.+|.|..-.
T Consensus        25 ~~~f~tl~~wy~v~ndyefq~rcpiilknsh~nk------hftfachlk~   68 (496)
T PF04684_consen   25 ARKFPTLEAWYNVINDYEFQSRCPIILKNSHRNK------HFTFACHLKN   68 (496)
T ss_pred             ccCCCcHHHHHHHHhhhhhhhcCceeeccccccc------ceEEEeeccC
Confidence            6789999999999999999998889888887752      6789996543


No 17 
>PF15299 ALS2CR8:  Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8
Probab=51.52  E-value=12  Score=31.80  Aligned_cols=19  Identities=26%  Similarity=0.600  Sum_probs=15.5

Q ss_pred             CCCCCcccccCCccEEEEE
Q 028717           84 NRKPRAVTREGCKAMIVVK  102 (205)
Q Consensus        84 ~~r~r~~tRtgC~A~m~vk  102 (205)
                      .++...+.+.+|||.|.|+
T Consensus        69 ~~~~~~skK~~CPA~I~Ik   87 (225)
T PF15299_consen   69 RRRSKPSKKRDCPARIYIK   87 (225)
T ss_pred             ccccccccCCCCCeEEEEE
Confidence            3456788999999999876


No 18 
>PF08222 HTH_CodY:  CodY helix-turn-helix domain;  InterPro: IPR013198 This family consists of the C-terminal helix-turn-helix domain found in several bacterial GTP-sensing transcriptional pleiotropic repressor CodY proteins. CodY has been found to repress the dipeptide transport operon (dpp) of Bacillus subtilis in nutrient-rich conditions []. The CodY protein also has a repressor effect on many genes in Lactococcus lactis during growth in milk [].; PDB: 2B0L_C.
Probab=43.84  E-value=11  Score=25.66  Aligned_cols=19  Identities=16%  Similarity=0.324  Sum_probs=14.6

Q ss_pred             CCccchhHHHHHHHHHHHh
Q 028717          180 HLSRNIDDIVQSVKQIEAK  198 (205)
Q Consensus       180 ~l~~~~~di~N~~k~~e~~  198 (205)
                      .+++|..-|+|.+|+||+-
T Consensus        13 ~~GiTRSvIVNALRKleSa   31 (61)
T PF08222_consen   13 RVGITRSVIVNALRKLESA   31 (61)
T ss_dssp             HHT--HHHHHHHHHHHHHT
T ss_pred             HhCccHHHHHHHHHHHHhc
Confidence            4678889999999999984


No 19 
>KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton]
Probab=42.86  E-value=20  Score=34.30  Aligned_cols=42  Identities=21%  Similarity=0.267  Sum_probs=34.2

Q ss_pred             cccccccCCCCCCCccCCeeCCHHHHHHHHHHHhhhcCcEEEEcc
Q 028717            8 QEMAVTKGSSDGEPYLGMEFESEEAAKVFYDAYATHMGFIMRVDA   52 (205)
Q Consensus         8 ~~~~~~e~~~~~~P~~Gm~F~S~eeA~~FY~~YA~~~GF~ir~~~   52 (205)
                      .-..++|.|+-   .+|..|-|++||.+||...-.+.+..=|+..
T Consensus       106 ~ffhtFegddc---~aGLnF~~E~EA~~F~k~V~~r~~~~nrk~~  147 (569)
T KOG3671|consen  106 TFFHTFEGDDC---QAGLNFASEEEAQKFRKKVQDRICHRNRKES  147 (569)
T ss_pred             cceeeeccccc---eeeecccCHHHHHHHHHHHHHHhhhhhhhcc
Confidence            34477887776   7899999999999999999888877755554


No 20 
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. Enabled-VASP-type homology (EVH1) domain. The EVH1 domain binds to other proteins at proline rich sequences. It is found in proteins involved in cytoskeletal reorganization such as Enabled and VASP. Ena-VASP type EVH1 domains specifically recognize FPPPP motifs in the focal adhesion proteins zyxin and vinculin, and the ActA surface protein of Listeria monocytogenes.  It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=39.81  E-value=19  Score=27.51  Aligned_cols=19  Identities=37%  Similarity=0.592  Sum_probs=16.8

Q ss_pred             ccCCeeCCHHHHHHHHHHH
Q 028717           22 YLGMEFESEEAAKVFYDAY   40 (205)
Q Consensus        22 ~~Gm~F~S~eeA~~FY~~Y   40 (205)
                      ..|..|.|++||..|...-
T Consensus        85 v~GLnF~Se~eA~~F~~~v  103 (111)
T cd01207          85 VYGLNFGSKEDATMFASAM  103 (111)
T ss_pred             EEeeccCCHHHHHHHHHHH
Confidence            6799999999999998764


No 21 
>PF12441 DUF3680:  Protein of unknown function (DUF3680) ;  InterPro: IPR022148  This domain family is found in bacteria and archaea, and is approximately 40 amino acids in length. 
Probab=38.89  E-value=24  Score=22.31  Aligned_cols=14  Identities=50%  Similarity=0.914  Sum_probs=13.0

Q ss_pred             eeCCHHHHHHHHHH
Q 028717           26 EFESEEAAKVFYDA   39 (205)
Q Consensus        26 ~F~S~eeA~~FY~~   39 (205)
                      +|.|++||.+|+..
T Consensus         7 ~f~se~Ee~eFW~~   20 (42)
T PF12441_consen    7 EFKSEEEEREFWDT   20 (42)
T ss_pred             CCCCHHHHHHHHHh
Confidence            79999999999987


No 22 
>PF08672 APC2:  Anaphase promoting complex (APC) subunit 2;  InterPro: IPR014786  The anaphase-promoting complex (APC) or cyclosome is a multi-subunit E3 protein ubiquitin ligase that regulates important events in mitosis such as the initiation of anaphase and exit from telophase. The APC, in conjunction with other enzymes, assembles multi-ubiquitin chains on a variety of regulatory proteins, thereby targeting them for proteolysis by the 26S proteasome. Anaphase is initiated when the APC triggers the destruction of securin, thereby allowing the protease, separase, to disrupt sister-chromatid cohesion. Securin ubiquitination by the APC is inhibited by cyclin-dependent kinase 1 (Cdk1)-dependent phosphorylation []. Forkhead Box M1 (FoxM1), which is a transcription factor that is over-expressed in many cancers, is degraded in late mitosis and early G1 phase by the APC/cyclosome (APC/C) E3 ubiquitin ligase []. The APC/C targets mitotic cyclins for destruction in mitosis and G1 phase and is then inactivated at S phase. It thereby generates alternating states of high and low cyclin-Cdk activity, which is required for the alternation of mitosis and DNA replication []. The APC/C is composed of at least 13 subunits that stay tightly associated throughout the cell cycle: APC1, APC2, APC4, APC5, APC9, APC11, CDC16, CDC23, CDC26, CDC27, DOC1, MND2 and SWM1[], []. In fission yeast the 13 subunits are known as: Apc1, Apc2, Nuc2, Apc4, Apc5, Cut9, Apc8, Apc10, Apc11, Hcn1, Apc13, Apc14 and Apc15 []. This entry represents a C-terminal domain found in APC subunit 2. ; PDB: 1LDD_A.
Probab=37.56  E-value=73  Score=21.48  Aligned_cols=40  Identities=3%  Similarity=0.140  Sum_probs=31.0

Q ss_pred             hhcHHHHHHHHHHhcCCCCCCccchhHHHHHHHHHHHhhh
Q 028717          161 AAYQEQLEMVLRDMENHSHHLSRNIDDIVQSVKQIEAKRI  200 (205)
Q Consensus       161 ~i~~~~i~~il~~~~g~~~~l~~~~~di~N~~k~~e~~~~  200 (205)
                      +.|..+|.++|+-+-.+....+++.+++..+|-++-.+++
T Consensus        11 sl~l~RIh~mLkmf~~~~~~~~~s~~eL~~fL~~lv~e~~   50 (60)
T PF08672_consen   11 SLPLDRIHSMLKMFPKDPGGYDISLEELQEFLDRLVEEGK   50 (60)
T ss_dssp             SEEHHHHHHHHHHH-GGG--TT--HHHHHHHHHHHHHTTS
T ss_pred             CCCHHHHHHHHHhccCCCCCCCCCHHHHHHHHHHHHHCCc
Confidence            4999999999999977789999999999999999887654


No 23 
>PF01693 Cauli_VI:  Caulimovirus viroplasmin;  InterPro: IPR011320 This entry represents the N-terminal domain of RNase HI, which has a 3-layer alpha/beta/alpha structure []. This domain is lacking in retroviral and prokaryotic enzymes, but shows a striking structural similarity to the ribosomal protein L9 N-terminal domain, and may function as a regulatory RNA-binding module. However, the topology of this domain differs from structures of known RNA binding domains such as the double-stranded RNA binding domain (dsRBD), the hnRNP K homology (KH) domain and the RNP motif. Eukaryotic RNases HI possess either one or two copies of this small N-terminal domain, in addition to the well-conserved catalytic RNase H domain. RNase HI belongs to the family of ribonuclease H enzymes that recognise RNA:DNA hybrids and degrade the RNA component. ; PDB: 1QHK_A 3BSU_C.
Probab=36.71  E-value=26  Score=21.86  Aligned_cols=13  Identities=31%  Similarity=0.442  Sum_probs=11.1

Q ss_pred             CCeeCCHHHHHHH
Q 028717           24 GMEFESEEAAKVF   36 (205)
Q Consensus        24 Gm~F~S~eeA~~F   36 (205)
                      =+.|+|.+||.+|
T Consensus        32 ~k~F~t~~eA~~~   44 (44)
T PF01693_consen   32 YKSFKTREEAEEF   44 (44)
T ss_dssp             EEEESSHHHHHHH
T ss_pred             ECCcCCHHHHhhC
Confidence            3789999999987


No 24 
>PF08471 Ribonuc_red_2_N:  Class II vitamin B12-dependent ribonucleotide reductase;  InterPro: IPR013678 This domain is found to the N terminus of the ribonucleotide reductase barrel domain (IPR000788 from INTERPRO). It occurs in bacterial class II ribonucleotide reductase proteins which depend upon coenzyme B12 (deoxyadenosylcobalamine) []. ; GO: 0004748 ribonucleoside-diphosphate reductase activity, 0050897 cobalt ion binding, 0055114 oxidation-reduction process
Probab=32.33  E-value=38  Score=25.14  Aligned_cols=17  Identities=41%  Similarity=0.679  Sum_probs=14.6

Q ss_pred             eeCCHHHHHHHHHHHhh
Q 028717           26 EFESEEAAKVFYDAYAT   42 (205)
Q Consensus        26 ~F~S~eeA~~FY~~YA~   42 (205)
                      -|+|+++|..||..-+.
T Consensus        72 YF~t~eDA~~FydEl~~   88 (93)
T PF08471_consen   72 YFATEEDAEAFYDELTY   88 (93)
T ss_pred             CcCCHHHHHHHHHHHHH
Confidence            59999999999987654


No 25 
>PF04684 BAF1_ABF1:  BAF1 / ABF1 chromatin reorganising factor;  InterPro: IPR006774 ABF1 is a sequence-specific DNA binding protein involved in transcription activation, gene silencing and initiation of DNA replication. ABF1 is known to remodel chromatin, and it is proposed that it mediates its effects on transcription and gene expression by modifying local chromatin architecture []. These functions require a conserved stretch of 20 amino acids in the C-terminal region of ABF1 (amino acids 639 to 662 Saccharomyces cerevisiae (P14164 from SWISSPROT)) []. The N-terminal two thirds of the protein are necessary for DNA binding, and the N terminus (amino acids 9 to 91 in S. cerevisiae) is thought to contain a novel zinc-finger motif which may stabilise the protein structure [].; GO: 0003677 DNA binding, 0006338 chromatin remodeling, 0005634 nucleus
Probab=30.85  E-value=31  Score=32.74  Aligned_cols=22  Identities=41%  Similarity=0.608  Sum_probs=18.8

Q ss_pred             CCcEEEEEEeecCCcccccCCC
Q 028717          106 TGKWVVTRFVKEHNHPLVAIPA  127 (205)
Q Consensus       106 ~gkW~V~~~~~eHNH~L~~~~~  127 (205)
                      .|-++|+++++-|||||....+
T Consensus       164 ~g~f~v~k~~~~h~h~l~~nl~  185 (496)
T PF04684_consen  164 KGPFVVTKIEPYHNHPLESNLS  185 (496)
T ss_pred             cCceEEEeeccccCCccccccc
Confidence            4779999999999999986544


No 26 
>PF08414 NADPH_Ox:  Respiratory burst NADPH oxidase;  InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism. It tends to occur to the N terminus of an EF-hand (IPR002048 from INTERPRO), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants []. ; GO: 0004601 peroxidase activity, 0050664 oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor, 0055114 oxidation-reduction process; PDB: 3A8R_A.
Probab=23.76  E-value=63  Score=24.32  Aligned_cols=25  Identities=36%  Similarity=0.561  Sum_probs=18.3

Q ss_pred             ccCCeeCCHHHHHHHHHHHhhhcCcE
Q 028717           22 YLGMEFESEEAAKVFYDAYATHMGFI   47 (205)
Q Consensus        22 ~~Gm~F~S~eeA~~FY~~YA~~~GF~   47 (205)
                      +|||. +|.|=|-+-|.+-|++-|-.
T Consensus        53 CIGM~-dSkeFA~eLFdALaRrr~i~   77 (100)
T PF08414_consen   53 CIGMK-DSKEFAGELFDALARRRGIK   77 (100)
T ss_dssp             HHT---S-HHHHHHHHHHHHHHTT--
T ss_pred             hcCCc-ccHHHHHHHHHHHHHhcCCc
Confidence            68999 99999999999999987654


No 27 
>PF11132 SplA:  Transcriptional regulator protein (SplA);  InterPro: IPR022608  The SplA protein functions in trans as a negative regulator of the level of splB-lacZ expression in the developing forespore []. 
Probab=23.23  E-value=62  Score=23.03  Aligned_cols=16  Identities=38%  Similarity=0.490  Sum_probs=14.4

Q ss_pred             CeeCCHHHHHHHHHHH
Q 028717           25 MEFESEEAAKVFYDAY   40 (205)
Q Consensus        25 m~F~S~eeA~~FY~~Y   40 (205)
                      -.|.|++||.+-|+.|
T Consensus        58 Avfss~~eAe~ay~~~   73 (75)
T PF11132_consen   58 AVFSSYEEAEQAYHEY   73 (75)
T ss_pred             hhhcCHHHHHHHHHHh
Confidence            4799999999999877


No 28 
>PF03462 PCRF:  PCRF domain;  InterPro: IPR005139 This domain is found in peptide chain release factors. Peptide chain release factors are important for protein synthesis since they direct the termination of translation in response to the peptide chain termination codons UAG and UAA. These are structurally distinct but both contain the PCRF domain [].; GO: 0016149 translation release factor activity, codon specific, 0006415 translational termination, 0005737 cytoplasm; PDB: 3D5A_X 3D5C_X 3MR8_V 3MS0_V 3F1G_X 3F1E_X 1ZBT_A 2IHR_1 2X9R_Y 2X9T_Y ....
Probab=20.97  E-value=3e+02  Score=20.59  Aligned_cols=25  Identities=24%  Similarity=0.388  Sum_probs=19.6

Q ss_pred             HHHHHHHHHHhhhcCcEEEEcceee
Q 028717           31 EAAKVFYDAYATHMGFIMRVDAFRR   55 (205)
Q Consensus        31 eeA~~FY~~YA~~~GF~ir~~~s~r   55 (205)
                      .+....|..||.+.||.+.+-....
T Consensus        66 ~~L~~MY~~~a~~~gw~~~~l~~~~   90 (115)
T PF03462_consen   66 EELFRMYQRYAERRGWKVEVLDYSP   90 (115)
T ss_dssp             HHHHHHHHHHHHHTT-EEEEEEEEE
T ss_pred             HHHHHHHHHHHHHcCCEEEEEecCC
Confidence            3557889999999999999887554


Done!