BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028719
(205 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3L9U|A Chain A, Crystal Structure Of Salmonella Enterica Serovar
Typhimurium Dsbl
Length = 201
Score = 29.3 bits (64), Expect = 1.4, Method: Compositional matrix adjust.
Identities = 13/36 (36%), Positives = 17/36 (47%)
Query: 42 LLDKSVPHVLHRWVVCLAVVSIYAVRVYLVQGFYII 77
L D +V L +W V I V Y+V G Y+I
Sbjct: 144 LKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLI 179
>pdb|2PQ0|A Chain A, Crystal Structure Of Hyopthetical Protein (Gk_1056) From
Geobacillus Kaustophilus Hta426
pdb|2PQ0|B Chain B, Crystal Structure Of Hyopthetical Protein (Gk_1056) From
Geobacillus Kaustophilus Hta426
pdb|2QYH|A Chain A, Crystal Structure Of The Hypothetical Protein (gk1056)
From Geobacillus Kaustophilus Hta426
pdb|2QYH|B Chain B, Crystal Structure Of The Hypothetical Protein (gk1056)
From Geobacillus Kaustophilus Hta426
pdb|2QYH|C Chain C, Crystal Structure Of The Hypothetical Protein (gk1056)
From Geobacillus Kaustophilus Hta426
pdb|2QYH|D Chain D, Crystal Structure Of The Hypothetical Protein (gk1056)
From Geobacillus Kaustophilus Hta426
Length = 258
Score = 26.6 bits (57), Expect = 9.8, Method: Compositional matrix adjust.
Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 6/56 (10%)
Query: 83 IYLLNLLMGFLSPQIDPEYSDGPTLPTR----GSDEFRPFVRRLPEFKF--WYCVT 132
I++ + F P +DP Y + + ++E P+VR PEF+F W+ V+
Sbjct: 119 IHVSXASLKFAHPPVDPLYYENKDIYQALLFCRAEEEEPYVRNYPEFRFVRWHDVS 174
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.331 0.145 0.482
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,492,500
Number of Sequences: 62578
Number of extensions: 213099
Number of successful extensions: 356
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 353
Number of HSP's gapped (non-prelim): 4
length of query: 205
length of database: 14,973,337
effective HSP length: 94
effective length of query: 111
effective length of database: 9,091,005
effective search space: 1009101555
effective search space used: 1009101555
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 49 (23.5 bits)