BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028719
         (205 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3L9U|A Chain A, Crystal Structure Of Salmonella Enterica Serovar
           Typhimurium Dsbl
          Length = 201

 Score = 29.3 bits (64), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 13/36 (36%), Positives = 17/36 (47%)

Query: 42  LLDKSVPHVLHRWVVCLAVVSIYAVRVYLVQGFYII 77
           L D +V   L +W     V  I  V  Y+V G Y+I
Sbjct: 144 LKDPAVQETLEKWKAAYDVAKIQGVPAYVVNGKYLI 179


>pdb|2PQ0|A Chain A, Crystal Structure Of Hyopthetical Protein (Gk_1056) From
           Geobacillus Kaustophilus Hta426
 pdb|2PQ0|B Chain B, Crystal Structure Of Hyopthetical Protein (Gk_1056) From
           Geobacillus Kaustophilus Hta426
 pdb|2QYH|A Chain A, Crystal Structure Of The Hypothetical Protein (gk1056)
           From Geobacillus Kaustophilus Hta426
 pdb|2QYH|B Chain B, Crystal Structure Of The Hypothetical Protein (gk1056)
           From Geobacillus Kaustophilus Hta426
 pdb|2QYH|C Chain C, Crystal Structure Of The Hypothetical Protein (gk1056)
           From Geobacillus Kaustophilus Hta426
 pdb|2QYH|D Chain D, Crystal Structure Of The Hypothetical Protein (gk1056)
           From Geobacillus Kaustophilus Hta426
          Length = 258

 Score = 26.6 bits (57), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 6/56 (10%)

Query: 83  IYLLNLLMGFLSPQIDPEYSDGPTLPTR----GSDEFRPFVRRLPEFKF--WYCVT 132
           I++    + F  P +DP Y +   +        ++E  P+VR  PEF+F  W+ V+
Sbjct: 119 IHVSXASLKFAHPPVDPLYYENKDIYQALLFCRAEEEEPYVRNYPEFRFVRWHDVS 174


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.331    0.145    0.482 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,492,500
Number of Sequences: 62578
Number of extensions: 213099
Number of successful extensions: 356
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 353
Number of HSP's gapped (non-prelim): 4
length of query: 205
length of database: 14,973,337
effective HSP length: 94
effective length of query: 111
effective length of database: 9,091,005
effective search space: 1009101555
effective search space used: 1009101555
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 49 (23.5 bits)