Citrus Sinensis ID: 028750


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVMERSKRTEMLRARAGASTGSV
cHHHHHHHHHHHccccEEEEEEEEcccccHHHHHHHHHHcccccccccccccccccccEEEEEEEccEEEEEEEccccccccccHHHHHccccEEEEEEEccccccHHHHHHHHHHHHcccccccccEEEEEccccccccccHHHHHHHccccccccccEEEEEccccccccHHHHHHHHHHHHHHHccccccccccccccccc
cccHHHHHcccccccccEEEEEEEcccccHHHHHHHHcHHHHHHcccccccccccccEEEEEEEEccEEEEEEEEcccHHHHccHHHHcccccEEEEEEEcccHHHHHHHHHHHHHHHccHHHcccEEEEEEEcccccccccHHHHHHHccHHHcccccEEEEEccccccccHHHHHHHHHHHcccccccccccccccccEccc
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSnveglppdrivptvglnigrievsnsklvfwdlggqpglrSIWEKYYEEAHAVVFVIdaacpsrfedSKTALEKVLRnedlqgapLLILAnkqdlpdavsADELARYLDLKKLDERVCMFEavsgydgfgiKESVEWLVEVMERSKRTEMLRARAGASTGSV
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVysnveglppdriVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEavsgydgfgiKESVEWLVEVMERskrtemlraragastgsv
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVMERSKRTEMLRARAGASTGSV
**SLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVM********************
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWL************************
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVMERSKRTE*************
*FSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVME*******************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVEVMERSKRTEMLRARAGASTGSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
Q63055201 ADP-ribosylation factor-r yes no 0.916 0.930 0.447 3e-44
Q8BXL7201 ADP-ribosylation factor-r yes no 0.916 0.930 0.447 3e-44
Q32LJ2201 ADP-ribosylation factor-r yes no 0.916 0.930 0.442 3e-44
Q5R579201 ADP-ribosylation factor-r yes no 0.916 0.930 0.442 4e-44
Q13795201 ADP-ribosylation factor-r yes no 0.916 0.930 0.442 4e-44
Q02804198 ADP-ribosylation factor-l yes no 0.916 0.944 0.364 1e-33
P38116183 ADP-ribosylation factor-l no no 0.862 0.961 0.381 3e-29
P61210182 ADP-ribosylation factor 1 N/A no 0.882 0.989 0.340 5e-29
P61209182 ADP-ribosylation factor 1 no no 0.882 0.989 0.340 5e-29
P51643181 ADP-ribosylation factor 1 N/A no 0.877 0.988 0.336 8e-29
>sp|Q63055|ARFRP_RAT ADP-ribosylation factor-related protein 1 OS=Rattus norvegicus GN=Arfrp1 PE=2 SV=1 Back     alignment and function desciption
 Score =  177 bits (450), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 85/190 (44%), Positives = 130/190 (68%), Gaps = 3/190 (1%)

Query: 1   MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYS-NVEGLPPDRIVPTVGLN 59
           M++L  GL+KY+F K E+ +LILG+D AGKTT LE+ K+ ++ N +G+   +I  TVGLN
Sbjct: 1   MYTLLSGLYKYMFQKDEYCILILGLDNAGKTTFLEQSKTRFNKNYKGMSLSKITTTVGLN 60

Query: 60  IGRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLR 119
           IG ++V  ++L+FWDLGGQ  L+S+W+KYY E H V++VID+    R  +SK A EKV+ 
Sbjct: 61  IGTVDVGKARLMFWDLGGQEELQSLWDKYYAECHGVIYVIDSTDEERLSESKEAFEKVVS 120

Query: 120 NEDLQGAPLLILANKQDLPDAVSADEL-ARYLDLK-KLDERVCMFEAVSGYDGFGIKESV 177
           +E L G P+L+LANKQD+   +S  ++   + D   K+  R C+ +A S   G G++E +
Sbjct: 121 SEALDGVPILVLANKQDVETCLSIPDIKTAFSDCTCKIGRRDCLTQACSALTGKGVREGI 180

Query: 178 EWLVEVMERS 187
           EW+V+ + R+
Sbjct: 181 EWMVKCVVRN 190




Possibly involved in plasma membrane-related signaling events.
Rattus norvegicus (taxid: 10116)
>sp|Q8BXL7|ARFRP_MOUSE ADP-ribosylation factor-related protein 1 OS=Mus musculus GN=Arfrp1 PE=2 SV=2 Back     alignment and function description
>sp|Q32LJ2|ARFRP_BOVIN ADP-ribosylation factor-related protein 1 OS=Bos taurus GN=ARFRP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R579|ARFRP_PONAB ADP-ribosylation factor-related protein 1 OS=Pongo abelii GN=ARFRP1 PE=2 SV=1 Back     alignment and function description
>sp|Q13795|ARFRP_HUMAN ADP-ribosylation factor-related protein 1 OS=Homo sapiens GN=ARFRP1 PE=1 SV=1 Back     alignment and function description
>sp|Q02804|ARL3_YEAST ADP-ribosylation factor-like protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL3 PE=1 SV=1 Back     alignment and function description
>sp|P38116|ARL1_YEAST ADP-ribosylation factor-like protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARL1 PE=1 SV=4 Back     alignment and function description
>sp|P61210|ARF1_LOCMI ADP-ribosylation factor 1 OS=Locusta migratoria GN=ARF1 PE=2 SV=2 Back     alignment and function description
>sp|P61209|ARF1_DROME ADP-ribosylation factor 1 OS=Drosophila melanogaster GN=Arf79F PE=2 SV=2 Back     alignment and function description
>sp|P51643|ARF1_XENLA ADP-ribosylation factor 1 OS=Xenopus laevis GN=arf1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
255539493204 ADP-ribosylation factor, putative [Ricin 0.980 0.980 0.9 1e-102
224120084204 predicted protein [Populus trichocarpa] 0.980 0.980 0.9 1e-102
356549001204 PREDICTED: ADP-ribosylation factor-relat 0.975 0.975 0.879 1e-101
449446037205 PREDICTED: ADP-ribosylation factor-relat 0.980 0.975 0.875 1e-100
449446039202 PREDICTED: ADP-ribosylation factor-relat 0.970 0.980 0.883 1e-100
224136948204 predicted protein [Populus trichocarpa] 0.980 0.980 0.875 1e-99
255646406204 unknown [Glycine max] 0.975 0.975 0.864 6e-99
359495822205 PREDICTED: ADP-ribosylation factor-relat 0.985 0.980 0.845 4e-98
217073166205 unknown [Medicago truncatula] gi|3884967 0.975 0.970 0.869 3e-97
363807218187 uncharacterized protein LOC100785527 [Gl 0.916 1.0 0.882 1e-95
>gi|255539493|ref|XP_002510811.1| ADP-ribosylation factor, putative [Ricinus communis] gi|223549926|gb|EEF51413.1| ADP-ribosylation factor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 180/200 (90%), Positives = 193/200 (96%)

Query: 1   MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNI 60
           MFSLFYGLWKY+F+KTEFHVLILGIDKAGKTTLLEKLKS+YSN+EGLPPDRIVPTVGLNI
Sbjct: 1   MFSLFYGLWKYLFSKTEFHVLILGIDKAGKTTLLEKLKSLYSNLEGLPPDRIVPTVGLNI 60

Query: 61  GRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRN 120
           GRIEVS++KLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDA CPSRFEDSK+ALEKVLR+
Sbjct: 61  GRIEVSSTKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDATCPSRFEDSKSALEKVLRH 120

Query: 121 EDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWL 180
           EDLQGAPLLILANKQDLPDA +A+E+ARYLDLKKLDERV MFEAVS YDG GI+ESVEWL
Sbjct: 121 EDLQGAPLLILANKQDLPDAATAEEIARYLDLKKLDERVYMFEAVSAYDGLGIRESVEWL 180

Query: 181 VEVMERSKRTEMLRARAGAS 200
           VEVMERSKRTEMLR RAG +
Sbjct: 181 VEVMERSKRTEMLRVRAGIT 200




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224120084|ref|XP_002318238.1| predicted protein [Populus trichocarpa] gi|118488882|gb|ABK96250.1| unknown [Populus trichocarpa x Populus deltoides] gi|222858911|gb|EEE96458.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356549001|ref|XP_003542887.1| PREDICTED: ADP-ribosylation factor-related protein 1-like [Glycine max] Back     alignment and taxonomy information
>gi|449446037|ref|XP_004140778.1| PREDICTED: ADP-ribosylation factor-related protein 1-like isoform 1 [Cucumis sativus] gi|449520110|ref|XP_004167077.1| PREDICTED: ADP-ribosylation factor-related protein 1-like isoform 1 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449446039|ref|XP_004140779.1| PREDICTED: ADP-ribosylation factor-related protein 1-like isoform 2 [Cucumis sativus] gi|449520112|ref|XP_004167078.1| PREDICTED: ADP-ribosylation factor-related protein 1-like isoform 2 [Cucumis sativus] Back     alignment and taxonomy information
>gi|224136948|ref|XP_002322456.1| predicted protein [Populus trichocarpa] gi|222869452|gb|EEF06583.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255646406|gb|ACU23682.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|359495822|ref|XP_002265687.2| PREDICTED: ADP-ribosylation factor-related protein 1-like [Vitis vinifera] gi|296086877|emb|CBI33044.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|217073166|gb|ACJ84942.1| unknown [Medicago truncatula] gi|388496722|gb|AFK36427.1| unknown [Medicago truncatula] gi|434856055|gb|AGB56248.1| ADP-ribosylation factor-like protein [Medicago falcata] Back     alignment and taxonomy information
>gi|363807218|ref|NP_001242354.1| uncharacterized protein LOC100785527 [Glycine max] gi|255647885|gb|ACU24401.1| unknown [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
TAIR|locus:2145151205 GB1 "GTP-binding protein 1" [A 0.970 0.965 0.838 4.3e-86
DICTYBASE|DDB_G0283631216 arfrp1 "ARF-like protein" [Dic 0.720 0.680 0.517 1.2e-45
UNIPROTKB|E1C1J0201 ARFRP1 "Uncharacterized protei 0.916 0.930 0.442 5.7e-43
FB|FBgn0030088200 CG7039 [Drosophila melanogaste 0.911 0.93 0.465 7.3e-43
MGI|MGI:1923938201 Arfrp1 "ADP-ribosylation facto 0.916 0.930 0.447 1.2e-42
RGD|621683201 Arfrp1 "ADP-ribosylation facto 0.916 0.930 0.447 1.2e-42
UNIPROTKB|Q32LJ2201 ARFRP1 "ADP-ribosylation facto 0.916 0.930 0.447 1.5e-42
ZFIN|ZDB-GENE-050227-14201 arfrp1 "ADP-ribosylation facto 0.916 0.930 0.442 1.9e-42
UNIPROTKB|Q13795201 ARFRP1 "ADP-ribosylation facto 0.916 0.930 0.447 3.2e-42
UNIPROTKB|J9P4D5201 ARFRP1 "Uncharacterized protei 0.916 0.930 0.442 3.6e-41
TAIR|locus:2145151 GB1 "GTP-binding protein 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 861 (308.1 bits), Expect = 4.3e-86, P = 4.3e-86
 Identities = 166/198 (83%), Positives = 184/198 (92%)

Query:     1 MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNI 60
             MFSL  GLW Y+F+KTEF+VLILGIDKAGKTT LEKLK++YS  EGLP DRIVPTVGLNI
Sbjct:     1 MFSLMSGLWSYMFSKTEFNVLILGIDKAGKTTFLEKLKTIYSISEGLPHDRIVPTVGLNI 60

Query:    61 GRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRN 120
             GRIEVSN+K+VFWDLGGQPGLRSIWEKYYEEAHA++++IDAACP+RFEDSK+ALEK LR+
Sbjct:    61 GRIEVSNAKIVFWDLGGQPGLRSIWEKYYEEAHALIYLIDAACPTRFEDSKSALEKALRH 120

Query:   121 EDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWL 180
             EDLQGAPLLILANKQDL +AVSA+EL RYLDLKKLDERV MFEAVSGYDG GIKES+EWL
Sbjct:   121 EDLQGAPLLILANKQDLTNAVSAEELDRYLDLKKLDERVYMFEAVSGYDGRGIKESIEWL 180

Query:   181 VEVMERSKRTEMLRARAG 198
             V VME+SKRTE LRARAG
Sbjct:   181 VGVMEKSKRTESLRARAG 198




GO:0005525 "GTP binding" evidence=IEA;ISS;IDA
GO:0005622 "intracellular" evidence=IEA
GO:0007264 "small GTPase mediated signal transduction" evidence=IEA
GO:0006891 "intra-Golgi vesicle-mediated transport" evidence=RCA
GO:0006944 "cellular membrane fusion" evidence=RCA
DICTYBASE|DDB_G0283631 arfrp1 "ARF-like protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|E1C1J0 ARFRP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0030088 CG7039 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1923938 Arfrp1 "ADP-ribosylation factor related protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621683 Arfrp1 "ADP-ribosylation factor related protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q32LJ2 ARFRP1 "ADP-ribosylation factor-related protein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050227-14 arfrp1 "ADP-ribosylation factor related protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q13795 ARFRP1 "ADP-ribosylation factor-related protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P4D5 ARFRP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q63055ARFRP_RATNo assigned EC number0.44730.91660.9303yesno
P0CM16ARF_CRYNJNo assigned EC number0.34460.81370.9120yesno
P36579ARF1_SCHPONo assigned EC number0.34850.80390.9111yesno
Q02804ARL3_YEASTNo assigned EC number0.36410.91660.9444yesno
Q5R579ARFRP_PONABNo assigned EC number0.44210.91660.9303yesno
Q8BXL7ARFRP_MOUSENo assigned EC number0.44730.91660.9303yesno
Q13795ARFRP_HUMANNo assigned EC number0.44210.91660.9303yesno
Q32LJ2ARFRP_BOVINNo assigned EC number0.44210.91660.9303yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
cd04160168 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) 5e-90
cd00878158 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf 3e-61
pfam00025174 pfam00025, Arf, ADP-ribosylation factor family 1e-51
cd04155174 cd04155, Arl3, Arf-like 3 (Arl3) GTPase 1e-48
cd04153174 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) 2e-47
cd04154173 cd04154, Arl2, Arf-like 2 (Arl2) GTPase 2e-47
PTZ00133182 PTZ00133, PTZ00133, ADP-ribosylation factor; Provi 6e-41
cd04156160 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 1e-40
cd04159159 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl 3e-40
cd04157162 cd04157, Arl6, Arf-like 6 (Arl6) GTPase 1e-39
cd00879191 cd00879, Sar1, Sar1 is an essential component of C 2e-39
cd04149168 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) 3e-39
cd04151158 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) 6e-39
smart00177175 smart00177, ARF, ARF-like small GTPases; ARF, ADP- 5e-38
cd04152183 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) 2e-37
PLN00223181 PLN00223, PLN00223, ADP-ribosylation factor; Provi 6e-37
cd04150159 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (A 1e-36
cd04161167 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (A 2e-34
cd04158169 cd04158, ARD1, (ADP-ribosylation factor domain pro 1e-32
cd04162164 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp 2e-30
smart00178184 smart00178, SAR, Sar1p-like members of the Ras-fam 2e-26
COG1100219 COG1100, COG1100, GTPase SAR1 and related small G 5e-21
cd00882161 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like s 4e-19
TIGR00231162 TIGR00231, small_GTP, small GTP-binding protein do 9e-15
COG2229187 COG2229, COG2229, Predicted GTPase [General functi 7e-14
cd04115170 cd04115, Rab33B_Rab33A, Rab GTPase family 33 inclu 3e-13
cd00154159 cd00154, Rab, Ras-related in brain (Rab) family of 2e-12
smart00175164 smart00175, RAB, Rab subfamily of small GTPases 6e-10
cd04114169 cd04114, Rab30, Rab GTPase family 30 (Rab30) 4e-09
cd04105202 cd04105, SR_beta, Signal recognition particle rece 9e-09
cd01864165 cd01864, Rab19, Rab GTPase family 19 (Rab19) 2e-08
cd01863161 cd01863, Rab18, Rab GTPase family 18 (Rab18) 4e-08
pfam00071162 pfam00071, Ras, Ras family 6e-08
cd01867167 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase familie 6e-07
cd01861161 cd01861, Rab6, Rab GTPase family 6 (Rab6) 6e-07
cd04110199 cd04110, Rab35, Rab GTPase family 35 (Rab35) 9e-07
pfam00503329 pfam00503, G-alpha, G-protein alpha subunit 2e-06
cd04109213 cd04109, Rab28, Rab GTPase family 28 (Rab28) 4e-06
pfam08477116 pfam08477, Miro, Miro-like protein 4e-06
cd04127180 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) 5e-06
cd04112191 cd04112, Rab26, Rab GTPase family 26 (Rab26) 8e-06
cd01865165 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, 9e-06
cd01869166 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes t 1e-05
cd04107201 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab1 1e-05
PLN03118211 PLN03118, PLN03118, Rab family protein; Provisiona 2e-05
PTZ00099176 PTZ00099, PTZ00099, rab6; Provisional 2e-05
cd04108170 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab3 2e-05
TIGR02729329 TIGR02729, Obg_CgtA, Obg family GTPase CgtA 3e-05
cd01866168 cd01866, Rab2, Rab GTPase family 2 (Rab2) 4e-05
cd04113161 cd04113, Rab4, Rab GTPase family 4 (Rab4) 4e-05
cd04119168 cd04119, RJL, Rab GTPase family J-like (RabJ-like) 6e-05
cd04111211 cd04111, Rab39, Rab GTPase family 39 (Rab39) 9e-05
cd04124161 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like 1e-04
cd04106162 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)- 1e-04
cd00157171 cd00157, Rho, Ras homology family (Rho) of small g 1e-04
cd00880161 cd00880, Era_like, E 3e-04
cd09912180 cd09912, DLP_2, Dynamin-like protein including dyn 3e-04
PLN03108210 PLN03108, PLN03108, Rab family protein; Provisiona 5e-04
cd01860163 cd01860, Rab5_related, Rab-related GTPase family i 5e-04
cd04122166 cd04122, Rab14, Rab GTPase family 14 (Rab14) 5e-04
cd04137180 cd04137, RheB, Ras Homolog Enriched in Brain (RheB 7e-04
cd04120202 cd04120, Rab12, Rab GTPase family 12 (Rab12) 8e-04
COG1160 444 COG1160, COG1160, Predicted GTPases [General funct 0.001
TIGR03594 429 TIGR03594, GTPase_EngA, ribosome-associated GTPase 0.002
cd04176163 cd04176, Rap2, Rap2 family GTPase consists of Rap2 0.002
cd01878204 cd01878, HflX, HflX GTPase family 0.002
pfam01926117 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase 0.002
cd04101167 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like 0.002
TIGR00073208 TIGR00073, hypB, hydrogenase accessory protein Hyp 0.003
cd04136164 cd04136, Rap_like, Rap-like family consists of Rap 0.003
smart00275342 smart00275, G_alpha, G protein alpha subunit 0.003
PRK12299335 PRK12299, obgE, GTPase CgtA; Reviewed 0.004
>gnl|CDD|206725 cd04160, Arfrp1, Arf-related protein 1 (Arfrp1) Back     alignment and domain information
 Score =  261 bits (668), Expect = 5e-90
 Identities = 91/167 (54%), Positives = 121/167 (72%), Gaps = 3/167 (1%)

Query: 20  VLILGIDKAGKTTLLEKLKSVYS-NVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQ 78
           VLILG+D AGKTT LE+ K+ +S N +GL P +I PTVGLNIG IEV  ++L+FWDLGGQ
Sbjct: 2   VLILGLDNAGKTTFLEQTKTKFSKNYKGLNPSKITPTVGLNIGTIEVGKARLMFWDLGGQ 61

Query: 79  PGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLP 138
             LRS+W+KYY E+H V++VID+    RF +SK+A EKV+ NE L+G PLL+LANKQDLP
Sbjct: 62  EELRSLWDKYYAESHGVIYVIDSTDRERFNESKSAFEKVINNEALEGVPLLVLANKQDLP 121

Query: 139 DAVSADELARYLDLK--KLDERVCMFEAVSGYDGFGIKESVEWLVEV 183
           DA+S  E+    D     +  R C+ + VS  +G G++E +EWLV+ 
Sbjct: 122 DALSVAEIKEVFDDCIALIGRRDCLVQPVSALEGEGVEEGIEWLVDC 168


Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif. Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes. It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network. Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D. Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development. Length = 168

>gnl|CDD|206644 cd00878, Arf_Arl, ADP-ribosylation factor(Arf)/Arf-like (Arl) small GTPases Back     alignment and domain information
>gnl|CDD|200938 pfam00025, Arf, ADP-ribosylation factor family Back     alignment and domain information
>gnl|CDD|206721 cd04155, Arl3, Arf-like 3 (Arl3) GTPase Back     alignment and domain information
>gnl|CDD|133353 cd04153, Arl5_Arl8, Arf-like 5 (Arl5) and 8 (Arl8) GTPases Back     alignment and domain information
>gnl|CDD|206720 cd04154, Arl2, Arf-like 2 (Arl2) GTPase Back     alignment and domain information
>gnl|CDD|173423 PTZ00133, PTZ00133, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|133356 cd04156, ARLTS1, Arf-like tumor suppressor gene 1 (ARLTS1 or Arl11) Back     alignment and domain information
>gnl|CDD|206724 cd04159, Arl10_like, Arf-like 9 (Arl9) and 10 (Arl10) GTPases Back     alignment and domain information
>gnl|CDD|206722 cd04157, Arl6, Arf-like 6 (Arl6) GTPase Back     alignment and domain information
>gnl|CDD|206645 cd00879, Sar1, Sar1 is an essential component of COPII vesicle coats Back     alignment and domain information
>gnl|CDD|206716 cd04149, Arf6, ADP ribosylation factor 6 (Arf6) Back     alignment and domain information
>gnl|CDD|206718 cd04151, Arl1, ADP ribosylation factor 1 (Arf1) Back     alignment and domain information
>gnl|CDD|128474 smart00177, ARF, ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>gnl|CDD|206719 cd04152, Arl4_Arl7, Arf-like 4 (Arl4) and 7 (Arl7) GTPases Back     alignment and domain information
>gnl|CDD|165788 PLN00223, PLN00223, ADP-ribosylation factor; Provisional Back     alignment and domain information
>gnl|CDD|206717 cd04150, Arf1_5_like, ADP-ribosylation factor-1 (Arf1) and ADP-ribosylation factor-5 (Arf5) Back     alignment and domain information
>gnl|CDD|133361 cd04161, Arl2l1_Arl13_like, Arl2-like protein 1 (Arl2l1) and Arl13 Back     alignment and domain information
>gnl|CDD|206723 cd04158, ARD1, (ADP-ribosylation factor domain protein 1 (ARD1) Back     alignment and domain information
>gnl|CDD|133362 cd04162, Arl9_Arfrp2_like, Arf-like 9 (Arl9)/Arfrp2-like GTPase Back     alignment and domain information
>gnl|CDD|197556 smart00178, SAR, Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>gnl|CDD|224025 COG1100, COG1100, GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|206648 cd00882, Ras_like_GTPase, Rat sarcoma (Ras)-like superfamily of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|232886 TIGR00231, small_GTP, small GTP-binding protein domain Back     alignment and domain information
>gnl|CDD|225138 COG2229, COG2229, Predicted GTPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|133315 cd04115, Rab33B_Rab33A, Rab GTPase family 33 includes Rab33A and Rab33B Back     alignment and domain information
>gnl|CDD|206640 cd00154, Rab, Ras-related in brain (Rab) family of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|197555 smart00175, RAB, Rab subfamily of small GTPases Back     alignment and domain information
>gnl|CDD|133314 cd04114, Rab30, Rab GTPase family 30 (Rab30) Back     alignment and domain information
>gnl|CDD|206691 cd04105, SR_beta, Signal recognition particle receptor, beta subunit (SR-beta), together with SR-alpha, forms the heterodimeric signal recognition particle (SRP) Back     alignment and domain information
>gnl|CDD|133267 cd01864, Rab19, Rab GTPase family 19 (Rab19) Back     alignment and domain information
>gnl|CDD|206656 cd01863, Rab18, Rab GTPase family 18 (Rab18) Back     alignment and domain information
>gnl|CDD|215692 pfam00071, Ras, Ras family Back     alignment and domain information
>gnl|CDD|206659 cd01867, Rab8_Rab10_Rab13_like, Rab GTPase families 8, 10, 13 (Rab8, Rab10, Rab13) Back     alignment and domain information
>gnl|CDD|206654 cd01861, Rab6, Rab GTPase family 6 (Rab6) Back     alignment and domain information
>gnl|CDD|133310 cd04110, Rab35, Rab GTPase family 35 (Rab35) Back     alignment and domain information
>gnl|CDD|215955 pfam00503, G-alpha, G-protein alpha subunit Back     alignment and domain information
>gnl|CDD|206694 cd04109, Rab28, Rab GTPase family 28 (Rab28) Back     alignment and domain information
>gnl|CDD|219856 pfam08477, Miro, Miro-like protein Back     alignment and domain information
>gnl|CDD|206700 cd04127, Rab27A, Rab GTPase family 27a (Rab27a) Back     alignment and domain information
>gnl|CDD|206695 cd04112, Rab26, Rab GTPase family 26 (Rab26) Back     alignment and domain information
>gnl|CDD|206657 cd01865, Rab3, Rab GTPase family 3 contains Rab3A, Rab3B, Rab3C and Rab3D Back     alignment and domain information
>gnl|CDD|206661 cd01869, Rab1_Ypt1, Rab GTPase family 1 includes the yeast homolog Ypt1 Back     alignment and domain information
>gnl|CDD|206692 cd04107, Rab32_Rab38, Rab GTPase families 18 (Rab18) and 32 (Rab32) Back     alignment and domain information
>gnl|CDD|215587 PLN03118, PLN03118, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|185444 PTZ00099, PTZ00099, rab6; Provisional Back     alignment and domain information
>gnl|CDD|206693 cd04108, Rab36_Rab34, Rab GTPase families 34 (Rab34) and 36 (Rab36) Back     alignment and domain information
>gnl|CDD|233986 TIGR02729, Obg_CgtA, Obg family GTPase CgtA Back     alignment and domain information
>gnl|CDD|206658 cd01866, Rab2, Rab GTPase family 2 (Rab2) Back     alignment and domain information
>gnl|CDD|206696 cd04113, Rab4, Rab GTPase family 4 (Rab4) Back     alignment and domain information
>gnl|CDD|133319 cd04119, RJL, Rab GTPase family J-like (RabJ-like) Back     alignment and domain information
>gnl|CDD|133311 cd04111, Rab39, Rab GTPase family 39 (Rab39) Back     alignment and domain information
>gnl|CDD|133324 cd04124, RabL2, Rab GTPase-like family 2 (Rab-like2) Back     alignment and domain information
>gnl|CDD|133306 cd04106, Rab23_like, Rab GTPase family 23 (Rab23)-like Back     alignment and domain information
>gnl|CDD|206641 cd00157, Rho, Ras homology family (Rho) of small guanosine triphosphatases (GTPases) Back     alignment and domain information
>gnl|CDD|206646 cd00880, Era_like, E Back     alignment and domain information
>gnl|CDD|206739 cd09912, DLP_2, Dynamin-like protein including dynamins, mitofusins, and guanylate-binding proteins Back     alignment and domain information
>gnl|CDD|178655 PLN03108, PLN03108, Rab family protein; Provisional Back     alignment and domain information
>gnl|CDD|206653 cd01860, Rab5_related, Rab-related GTPase family includes Rab5 and Rab22; regulates early endosome fusion Back     alignment and domain information
>gnl|CDD|133322 cd04122, Rab14, Rab GTPase family 14 (Rab14) Back     alignment and domain information
>gnl|CDD|206709 cd04137, RheB, Ras Homolog Enriched in Brain (RheB) is a small GTPase Back     alignment and domain information
>gnl|CDD|206699 cd04120, Rab12, Rab GTPase family 12 (Rab12) Back     alignment and domain information
>gnl|CDD|224082 COG1160, COG1160, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|234274 TIGR03594, GTPase_EngA, ribosome-associated GTPase EngA Back     alignment and domain information
>gnl|CDD|133376 cd04176, Rap2, Rap2 family GTPase consists of Rap2a, Rap2b, and Rap2c Back     alignment and domain information
>gnl|CDD|206666 cd01878, HflX, HflX GTPase family Back     alignment and domain information
>gnl|CDD|216791 pfam01926, MMR_HSR1, 50S ribosome-binding GTPase Back     alignment and domain information
>gnl|CDD|206688 cd04101, RabL4, Rab GTPase-like family 4 (Rab-like4) Back     alignment and domain information
>gnl|CDD|232811 TIGR00073, hypB, hydrogenase accessory protein HypB Back     alignment and domain information
>gnl|CDD|206708 cd04136, Rap_like, Rap-like family consists of Rap1, Rap2 and RSR1 Back     alignment and domain information
>gnl|CDD|214595 smart00275, G_alpha, G protein alpha subunit Back     alignment and domain information
>gnl|CDD|237048 PRK12299, obgE, GTPase CgtA; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
PLN00223181 ADP-ribosylation factor; Provisional 100.0
KOG0084205 consensus GTPase Rab1/YPT1, small G protein superf 100.0
PTZ00133182 ADP-ribosylation factor; Provisional 100.0
KOG0092200 consensus GTPase Rab5/YPT51 and related small G pr 100.0
cd04149168 Arf6 Arf6 subfamily. Arf6 (ADP ribosylation factor 100.0
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation 100.0
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 100.0
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfami 100.0
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) a 99.98
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 99.98
cd04120202 Rab12 Rab12 subfamily. Rab12 was first identified 99.98
KOG0078207 consensus GTP-binding protein SEC4, small G protei 99.98
KOG0094221 consensus GTPase Rab6/YPT6/Ryh1, small G protein s 99.98
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor 99.97
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab 99.97
KOG0098216 consensus GTPase Rab2, small G protein superfamily 99.97
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like p 99.97
cd04133176 Rop_like Rop subfamily. The Rop (Rho-related prote 99.97
smart00178184 SAR Sar1p-like members of the Ras-family of small 99.97
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 99.97
PF00025175 Arf: ADP-ribosylation factor family The prints ent 99.97
PTZ00369189 Ras-like protein; Provisional 99.97
cd04127180 Rab27A Rab27a subfamily. The Rab27a subfamily cons 99.97
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE 99.97
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized 99.97
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high se 99.97
cd04126220 Rab20 Rab20 subfamily. Rab20 is one of several Rab 99.97
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a sub 99.97
KOG0080209 consensus GTPase Rab18, small G protein superfamil 99.97
KOG0076197 consensus GTP-binding ADP-ribosylation factor-like 99.97
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfam 99.97
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes t 99.97
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of t 99.97
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 99.97
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) i 99.97
cd04131178 Rnd Rnd subfamily. The Rnd subfamily contains Rnd1 99.97
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-lik 99.97
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 99.97
PLN03071219 GTP-binding nuclear protein Ran; Provisional 99.97
cd04161167 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily. Arl2l1 ( 99.97
KOG0079198 consensus GTP-binding protein H-ray, small G prote 99.97
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 99.97
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 99.97
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 99.97
cd04174232 Rnd1_Rho6 Rnd1/Rho6 subfamily. Rnd1/Rho6 is a memb 99.97
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 99.97
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 99.97
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 99.97
cd01865165 Rab3 Rab3 subfamily. The Rab3 subfamily contains R 99.97
KOG0075186 consensus GTP-binding ADP-ribosylation factor-like 99.97
cd01874175 Cdc42 Cdc42 subfamily. Cdc42 is an essential GTPas 99.97
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 99.96
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab 99.96
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 99.96
KOG0070181 consensus GTP-binding ADP-ribosylation factor Arf1 99.96
cd04144190 Ras2 Ras2 subfamily. The Ras2 subfamily, found exc 99.96
KOG0073185 consensus GTP-binding ADP-ribosylation factor-like 99.96
cd01871174 Rac1_like Rac1-like subfamily. The Rac1-like subfa 99.96
cd04109215 Rab28 Rab28 subfamily. First identified in maize, 99.96
KOG0093193 consensus GTPase Rab3, small G protein superfamily 99.96
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 99.96
KOG0394210 consensus Ras-related GTPase [General function pre 99.96
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the 99.96
cd04111211 Rab39 Rab39 subfamily. Found in eukaryotes, Rab39 99.96
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was fi 99.96
cd04173222 Rnd2_Rho7 Rnd2/Rho7 subfamily. Rnd2/Rho7 is a memb 99.96
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 99.96
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 99.96
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found pr 99.96
cd04125188 RabA_like RabA-like subfamily. RabA was first iden 99.96
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member 99.96
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of t 99.96
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 99.96
KOG0095213 consensus GTPase Rab30, small G protein superfamil 99.96
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosom 99.96
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog memb 99.96
PLN03110216 Rab GTPase; Provisional 99.96
cd04134189 Rho3 Rho3 subfamily. Rho3 is a member of the Rho f 99.96
cd04115170 Rab33B_Rab33A Rab33B/Rab33A subfamily. Rab33B is u 99.96
KOG0086214 consensus GTPase Rab4, small G protein superfamily 99.96
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 99.96
PF00071162 Ras: Ras family; InterPro: IPR001806 Small GTPases 99.96
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 99.96
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 99.96
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase th 99.96
cd04103158 Centaurin_gamma Centaurin gamma. The centaurins (a 99.96
cd04112191 Rab26 Rab26 subfamily. First identified in rat pan 99.96
KOG0087222 consensus GTPase Rab11/YPT3, small G protein super 99.96
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 99.96
cd04143247 Rhes_like Rhes_like subfamily. This subfamily incl 99.96
smart00176200 RAN Ran (Ras-related nuclear proteins) /TC4 subfam 99.96
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 99.96
cd04177168 RSR1 RSR1 subgroup. RSR1/Bud1p is a member of the 99.96
PLN03108210 Rab family protein; Provisional 99.96
cd04101164 RabL4 RabL4 (Rab-like4) subfamily. RabL4s are nove 99.96
cd01873195 RhoBTB RhoBTB subfamily. Members of the RhoBTB sub 99.96
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 99.96
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 99.96
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 99.96
cd04142198 RRP22 RRP22 subfamily. RRP22 (Ras-related protein 99.96
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 99.95
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small 99.95
cd04123162 Rab21 Rab21 subfamily. The localization and functi 99.95
PLN03118211 Rab family protein; Provisional 99.95
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from othe 99.95
cd01892169 Miro2 Miro2 subfamily. Miro (mitochondrial Rho) pr 99.95
cd04147198 Ras_dva Ras-dva subfamily. Ras-dva (Ras - dorsal-v 99.95
KOG0071180 consensus GTP-binding ADP-ribosylation factor Arf6 99.95
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein 99.95
cd04148221 RGK RGK subfamily. The RGK (Rem, Rem2, Rad, Gem/Ki 99.95
KOG0091213 consensus GTPase Rab39, small G protein superfamil 99.95
cd00154159 Rab Rab family. Rab GTPases form the largest famil 99.95
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) pr 99.95
cd04146165 RERG_RasL11_like RERG/RasL11-like subfamily. RERG 99.95
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily 99.94
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 99.94
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 99.94
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive 99.94
cd00876160 Ras Ras family. The Ras family of the Ras superfam 99.94
KOG0088218 consensus GTPase Rab21, small G protein superfamil 99.94
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 99.94
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 99.94
cd01897168 NOG NOG1 is a nucleolar GTP-binding protein presen 99.93
KOG0395196 consensus Ras-related GTPase [General function pre 99.93
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 99.93
KOG0081219 consensus GTPase Rab27, small G protein superfamil 99.93
cd01898170 Obg Obg subfamily. The Obg nucleotide binding prot 99.93
cd04171164 SelB SelB subfamily. SelB is an elongation factor 99.92
PRK12299335 obgE GTPase CgtA; Reviewed 99.92
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase fa 99.92
cd01878204 HflX HflX subfamily. A distinct conserved domain w 99.92
KOG0097215 consensus GTPase Rab14, small G protein superfamil 99.92
KOG0074185 consensus GTP-binding ADP-ribosylation factor-like 99.92
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are nove 99.91
PF00009188 GTP_EFTU: Elongation factor Tu GTP binding domain; 99.91
TIGR02729329 Obg_CgtA Obg family GTPase CgtA. This model descri 99.91
cd01887168 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryo 99.91
KOG0072182 consensus GTP-binding ADP-ribosylation factor-like 99.91
KOG0083192 consensus GTPase Rab26/Rab37, small G protein supe 99.91
PF02421156 FeoB_N: Ferrous iron transport protein B; InterPro 99.91
TIGR03156351 GTP_HflX GTP-binding protein HflX. This protein fa 99.9
TIGR00231161 small_GTP small GTP-binding protein domain. This m 99.9
cd00881189 GTP_translation_factor GTP translation factor fami 99.9
cd01888203 eIF2_gamma eIF2-gamma (gamma subunit of initiation 99.9
cd01889192 SelB_euk SelB subfamily. SelB is an elongation fac 99.9
TIGR02528142 EutP ethanolamine utilization protein, EutP. This 99.9
PRK15494 339 era GTPase Era; Provisional 99.9
TIGR00436270 era GTP-binding protein Era. Era is an essential G 99.9
cd01891194 TypA_BipA TypA (tyrosine phosphorylated protein A) 99.9
PRK03003472 GTP-binding protein Der; Reviewed 99.9
cd04164157 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein 99.9
KOG4252246 consensus GTP-binding protein [Signal transduction 99.89
PRK04213201 GTP-binding protein; Provisional 99.89
cd01881176 Obg_like The Obg-like subfamily consists of five w 99.89
PRK12296 500 obgE GTPase CgtA; Reviewed 99.89
cd01879158 FeoB Ferrous iron transport protein B (FeoB) subfa 99.89
cd01895174 EngA2 EngA2 subfamily. This CD represents the seco 99.89
PRK05291449 trmE tRNA modification GTPase TrmE; Reviewed 99.89
cd00882157 Ras_like_GTPase Ras-like GTPase superfamily. The R 99.89
PRK12297424 obgE GTPase CgtA; Reviewed 99.89
PLN00023 334 GTP-binding protein; Provisional 99.89
TIGR03594429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.88
PRK03003 472 GTP-binding protein Der; Reviewed 99.88
PRK15467158 ethanolamine utilization protein EutP; Provisional 99.88
TIGR00450442 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE 99.88
COG1100219 GTPase SAR1 and related small G proteins [General 99.88
COG2229187 Predicted GTPase [General function prediction only 99.88
PTZ00099176 rab6; Provisional 99.88
cd01894157 EngA1 EngA1 subfamily. This CD represents the firs 99.88
KOG0393198 consensus Ras-related small GTPase, Rho type [Gene 99.87
cd04105203 SR_beta Signal recognition particle receptor, beta 99.87
PRK11058426 GTPase HflX; Provisional 99.87
TIGR01393 595 lepA GTP-binding protein LepA. LepA (GUF1 in Sacca 99.87
COG1159 298 Era GTPase [General function prediction only] 99.87
PRK12298390 obgE GTPase CgtA; Reviewed 99.87
PRK00093435 GTP-binding protein Der; Reviewed 99.87
PRK00454196 engB GTP-binding protein YsxC; Reviewed 99.87
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 99.87
TIGR00483 426 EF-1_alpha translation elongation factor EF-1 alph 99.86
TIGR00487 587 IF-2 translation initiation factor IF-2. This mode 99.86
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 99.86
PRK09518712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.86
TIGR00475 581 selB selenocysteine-specific elongation factor Sel 99.86
PRK12317 425 elongation factor 1-alpha; Reviewed 99.86
cd01884195 EF_Tu EF-Tu subfamily. This subfamily includes ort 99.86
PRK05306 787 infB translation initiation factor IF-2; Validated 99.86
TIGR03598179 GTPase_YsxC ribosome biogenesis GTP-binding protei 99.85
PRK00093 435 GTP-binding protein Der; Reviewed 99.85
PRK04000 411 translation initiation factor IF-2 subunit gamma; 99.85
PRK00089 292 era GTPase Era; Reviewed 99.85
cd00880163 Era_like Era (E. coli Ras-like protein)-like. This 99.85
COG1160 444 Predicted GTPases [General function prediction onl 99.85
PRK05433 600 GTP-binding protein LepA; Provisional 99.85
cd01896233 DRG The developmentally regulated GTP-binding prot 99.85
CHL00189 742 infB translation initiation factor 2; Provisional 99.85
TIGR03594 429 GTPase_EngA ribosome-associated GTPase EngA. EngA 99.85
TIGR03680 406 eif2g_arch translation initiation factor 2 subunit 99.84
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), T 99.84
cd04166208 CysN_ATPS CysN_ATPS subfamily. CysN, together with 99.84
COG1160444 Predicted GTPases [General function prediction onl 99.84
TIGR01394 594 TypA_BipA GTP-binding protein TypA/BipA. This bact 99.83
cd01883219 EF1_alpha Eukaryotic elongation factor 1 (EF1) alp 99.83
PRK09518 712 bifunctional cytidylate kinase/GTPase Der; Reviewe 99.83
TIGR00491 590 aIF-2 translation initiation factor aIF-2/yIF-2. T 99.83
PRK10218 607 GTP-binding protein; Provisional 99.82
COG0218200 Predicted GTPase [General function prediction only 99.82
COG0486454 ThdF Predicted GTPase [General function prediction 99.82
PRK09554 772 feoB ferrous iron transport protein B; Reviewed 99.82
PRK10512 614 selenocysteinyl-tRNA-specific translation factor; 99.82
KOG3883198 consensus Ras family small GTPase [Signal transduc 99.82
PRK12736 394 elongation factor Tu; Reviewed 99.81
KOG1489366 consensus Predicted GTP-binding protein (ODN super 99.81
cd04165224 GTPBP1_like GTPBP1-like. Mammalian GTP binding pro 99.81
PRK04004 586 translation initiation factor IF-2; Validated 99.81
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 99.81
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 99.81
TIGR00437 591 feoB ferrous iron transporter FeoB. FeoB (773 amin 99.8
PRK12735 396 elongation factor Tu; Reviewed 99.8
CHL00071 409 tufA elongation factor Tu 99.79
COG1163365 DRG Predicted GTPase [General function prediction 99.79
COG1084346 Predicted GTPase [General function prediction only 99.79
COG2262411 HflX GTPases [General function prediction only] 99.79
PLN00043 447 elongation factor 1-alpha; Provisional 99.78
TIGR00485 394 EF-Tu translation elongation factor TU. This align 99.78
cd04167213 Snu114p Snu114p subfamily. Snu114p is one of sever 99.78
KOG0077193 consensus Vesicle coat complex COPII, GTPase subun 99.78
cd01885222 EF2 EF2 (for archaea and eukarya). Translocation r 99.78
PRK00049 396 elongation factor Tu; Reviewed 99.77
PLN03126 478 Elongation factor Tu; Provisional 99.77
cd01876170 YihA_EngB The YihA (EngB) subfamily. This subfamil 99.77
PLN03127 447 Elongation factor Tu; Provisional 99.77
COG0532 509 InfB Translation initiation factor 2 (IF-2; GTPase 99.77
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translo 99.77
PRK05124 474 cysN sulfate adenylyltransferase subunit 1; Provis 99.77
PTZ00327 460 eukaryotic translation initiation factor 2 gamma s 99.77
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase 99.77
PTZ00141 446 elongation factor 1- alpha; Provisional 99.77
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Tr 99.77
COG5256 428 TEF1 Translation elongation factor EF-1alpha (GTPa 99.76
TIGR02034 406 CysN sulfate adenylyltransferase, large subunit. H 99.75
PRK13351 687 elongation factor G; Reviewed 99.75
COG0370 653 FeoB Fe2+ transport system protein B [Inorganic io 99.75
PRK05506 632 bifunctional sulfate adenylyltransferase subunit 1 99.75
KOG0096216 consensus GTPase Ran/TC4/GSP1 (nuclear protein tra 99.74
PRK00741 526 prfC peptide chain release factor 3; Provisional 99.74
COG0536369 Obg Predicted GTPase [General function prediction 99.74
KOG0462 650 consensus Elongation factor-type GTP-binding prote 99.74
KOG0090238 consensus Signal recognition particle receptor, be 99.73
TIGR00503 527 prfC peptide chain release factor 3. This translat 99.71
KOG1707 625 consensus Predicted Ras related/Rac-GTP binding pr 99.71
PF04670232 Gtr1_RagA: Gtr1/RagA G protein conserved region; I 99.7
PF09439181 SRPRB: Signal recognition particle receptor beta s 99.7
KOG1673205 consensus Ras GTPases [General function prediction 99.7
KOG1423379 consensus Ras-like GTPase ERA [Cell cycle control, 99.69
KOG1145 683 consensus Mitochondrial translation initiation fac 99.69
TIGR00484 689 EF-G translation elongation factor EF-G. After pep 99.69
PRK12739 691 elongation factor G; Reviewed 99.69
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 99.68
PRK00007 693 elongation factor G; Reviewed 99.67
cd01899318 Ygr210 Ygr210 subfamily. Ygr210 is a member of Obg 99.67
cd01852196 AIG1 AIG1 (avrRpt2-induced gene 1). This represent 99.67
KOG1191531 consensus Mitochondrial GTPase [Translation, ribos 99.65
PRK09866 741 hypothetical protein; Provisional 99.65
COG0481 603 LepA Membrane GTPase LepA [Cell envelope biogenesi 99.64
KOG4423229 consensus GTP-binding protein-like, RAS superfamil 99.64
cd00066317 G-alpha G protein alpha subunit. The alpha subunit 99.63
COG0050 394 TufB GTPases - translation elongation factors [Tra 99.63
smart00275342 G_alpha G protein alpha subunit. Subunit of G prot 99.63
PRK12740 668 elongation factor G; Reviewed 99.62
COG5257 415 GCD11 Translation initiation factor 2, gamma subun 99.62
PRK09602 396 translation-associated GTPase; Reviewed 99.61
PRK13768253 GTPase; Provisional 99.6
COG2895 431 CysN GTPases - Sulfate adenylate transferase subun 99.6
COG3596296 Predicted GTPase [General function prediction only 99.59
COG1217 603 TypA Predicted membrane GTPase involved in stress 99.59
KOG1532366 consensus GTPase XAB1, interacts with DNA repair p 99.58
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 99.57
COG4917148 EutP Ethanolamine utilization protein [Amino acid 99.57
KOG1490 620 consensus GTP-binding protein CRFG/NOG1 (ODN super 99.57
KOG0458 603 consensus Elongation factor 1 alpha [Translation, 99.56
cd01850276 CDC_Septin CDC/Septin. Septins are a conserved fam 99.56
PRK09435332 membrane ATPase/protein kinase; Provisional 99.55
PRK14845 1049 translation initiation factor IF-2; Provisional 99.53
PRK07560 731 elongation factor EF-2; Reviewed 99.51
TIGR00490 720 aEF-2 translation elongation factor aEF-2. This mo 99.5
PF04548212 AIG1: AIG1 family; InterPro: IPR006703 This entry 99.49
PF05049 376 IIGP: Interferon-inducible GTPase (IIGP); InterPro 99.49
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily co 99.49
PTZ00416 836 elongation factor 2; Provisional 99.48
KOG0082354 consensus G-protein alpha subunit (small G protein 99.47
KOG0461 522 consensus Selenocysteine-specific elongation facto 99.47
COG3276 447 SelB Selenocysteine-specific translation elongatio 99.46
PLN00116 843 translation elongation factor EF-2 subunit; Provis 99.46
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 99.45
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 99.45
PTZ00258 390 GTP-binding protein; Provisional 99.45
COG4108 528 PrfC Peptide chain release factor RF-3 [Translatio 99.44
TIGR00101199 ureG urease accessory protein UreG. This model rep 99.44
KOG0460 449 consensus Mitochondrial translation elongation fac 99.43
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 99.43
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 99.42
KOG1144 1064 consensus Translation initiation factor 5B (eIF-5B 99.4
COG0480 697 FusA Translation elongation factors (GTPases) [Tra 99.39
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 99.39
TIGR00073207 hypB hydrogenase accessory protein HypB. HypB is i 99.37
PRK09601 364 GTP-binding protein YchF; Reviewed 99.36
KOG1486364 consensus GTP-binding protein DRG2 (ODN superfamil 99.36
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 99.35
KOG0410410 consensus Predicted GTP binding protein [General f 99.32
TIGR02836 492 spore_IV_A stage IV sporulation protein A. A compa 99.29
smart00053240 DYNc Dynamin, GTPase. Large GTPases that mediate v 99.27
KOG3905 473 consensus Dynein light intermediate chain [Cell mo 99.26
TIGR00157 245 ribosome small subunit-dependent GTPase A. The Aqu 99.25
PF00350168 Dynamin_N: Dynamin family; InterPro: IPR001401 Mem 99.24
PF00503389 G-alpha: G-protein alpha subunit; InterPro: IPR001 99.24
KOG1487358 consensus GTP-binding protein DRG1 (ODN superfamil 99.23
KOG1707625 consensus Predicted Ras related/Rac-GTP binding pr 99.23
PF00735281 Septin: Septin; InterPro: IPR000038 Septins consti 99.21
COG0378202 HypB Ni2+-binding GTPase involved in regulation of 99.19
COG0012 372 Predicted GTPase, probable translation factor [Tra 99.19
smart00010124 small_GTPase Small GTPase of the Ras superfamily; 99.18
TIGR00993 763 3a0901s04IAP86 chloroplast protein import componen 99.14
KOG0085359 consensus G protein subunit Galphaq/Galphay, small 99.14
PF05783 472 DLIC: Dynein light intermediate chain (DLIC); Inte 99.13
COG5258 527 GTPBP1 GTPase [General function prediction only] 99.13
KOG0468 971 consensus U5 snRNP-specific protein [Translation, 99.11
KOG3887 347 consensus Predicted small GTPase involved in nucle 99.11
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 99.07
cd01900274 YchF YchF subfamily. YchF is a member of the Obg f 99.06
KOG0466 466 consensus Translation initiation factor 2, gamma s 99.06
KOG0705 749 consensus GTPase-activating protein Centaurin gamm 99.03
COG5019 373 CDC3 Septin family protein [Cell division and chro 98.96
KOG0099379 consensus G protein subunit Galphas, small G prote 98.96
KOG3886295 consensus GTP-binding protein [Signal transduction 98.96
PRK12289 352 GTPase RsgA; Reviewed 98.94
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.93
cd01854 287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.93
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.9
PRK00098 298 GTPase RsgA; Reviewed 98.89
KOG2655 366 consensus Septin family protein (P-loop GTPase) [C 98.89
KOG0447 980 consensus Dynamin-like GTP binding protein [Genera 98.84
KOG2486320 consensus Predicted GTPase [General function predi 98.84
KOG1547336 consensus Septin CDC10 and related P-loop GTPases 98.82
KOG0459 501 consensus Polypeptide release factor 3 [Translatio 98.82
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.79
PRK12288 347 GTPase RsgA; Reviewed 98.78
KOG1143 591 consensus Predicted translation elongation factor 98.78
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.78
TIGR03596 276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.77
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome 98.77
cd01858157 NGP_1 NGP-1. Autoantigen NGP-1 (Nucleolar G-protei 98.74
TIGR00092 368 GTP-binding protein YchF. This predicted GTP-bindi 98.74
KOG0467 887 consensus Translation elongation factor 2/ribosome 98.73
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 98.71
KOG1954 532 consensus Endocytosis/signaling protein EHD1 [Sign 98.67
TIGR03597 360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.65
cd01855190 YqeH YqeH. YqeH is an essential GTP-binding protei 98.65
KOG0465 721 consensus Mitochondrial elongation factor [Transla 98.65
PRK09563 287 rbgA GTPase YlqF; Reviewed 98.65
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.64
KOG0464 753 consensus Elongation factor G [Translation, riboso 98.64
cd01857141 HSR1_MMR1 HSR1/MMR1. Human HSR1, is localized to t 98.62
KOG1534273 consensus Putative transcription factor FET5 [Tran 98.6
KOG1491 391 consensus Predicted GTP-binding protein (ODN super 98.57
COG1161322 Predicted GTPases [General function prediction onl 98.52
TIGR03348 1169 VI_IcmF type VI secretion protein IcmF. Members of 98.51
PRK10416318 signal recognition particle-docking protein FtsY; 98.51
cd01849155 YlqF_related_GTPase YlqF-related GTPases. These pr 98.5
cd03112158 CobW_like The function of this protein family is u 98.47
cd01851224 GBP Guanylate-binding protein (GBP), N-terminal do 98.46
PF09547 492 Spore_IV_A: Stage IV sporulation protein A (spore_ 98.45
TIGR03596276 GTPase_YlqF ribosome biogenesis GTP-binding protei 98.44
KOG0448 749 consensus Mitofusin 1 GTPase, involved in mitochon 98.44
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 98.44
PRK14974336 cell division protein FtsY; Provisional 98.43
TIGR03597360 GTPase_YqeH ribosome biogenesis GTPase YqeH. This 98.41
TIGR00064272 ftsY signal recognition particle-docking protein F 98.4
cd01856171 YlqF YlqF. Proteins of the YlqF family contain all 98.39
PRK12288347 GTPase RsgA; Reviewed 98.39
PRK09563287 rbgA GTPase YlqF; Reviewed 98.38
COG1618179 Predicted nucleotide kinase [Nucleotide transport 98.38
TIGR00157245 ribosome small subunit-dependent GTPase A. The Aqu 98.37
PRK13796 365 GTPase YqeH; Provisional 98.32
cd01859156 MJ1464 MJ1464. This family represents archaeal GTP 98.32
PRK01889 356 GTPase RsgA; Reviewed 98.31
TIGR01425 429 SRP54_euk signal recognition particle protein SRP5 98.28
PRK12289352 GTPase RsgA; Reviewed 98.28
KOG0463 641 consensus GTP-binding protein GP-1 [General functi 98.27
cd01854287 YjeQ_engC YjeQ/EngC. YjeQ (YloQ in Bacillus subtil 98.21
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 98.19
PRK13796365 GTPase YqeH; Provisional 98.18
KOG3859 406 consensus Septins (P-loop GTPases) [Cell cycle con 98.18
cd03114148 ArgK-like The function of this protein family is u 98.17
KOG1533290 consensus Predicted GTPase [General function predi 98.16
KOG2485335 consensus Conserved ATP/GTP binding protein [Gener 98.16
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 98.16
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 98.15
cd03115173 SRP The signal recognition particle (SRP) mediates 98.15
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 98.15
COG0523 323 Putative GTPases (G3E family) [General function pr 98.14
KOG2423572 consensus Nucleolar GTPase [General function predi 98.11
COG1162301 Predicted GTPases [General function prediction onl 98.11
PRK00098298 GTPase RsgA; Reviewed 98.05
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 98.03
PRK11537318 putative GTP-binding protein YjiA; Provisional 98.03
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 97.96
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 97.96
KOG0469 842 consensus Elongation factor 2 [Translation, riboso 97.95
PRK13695174 putative NTPase; Provisional 97.94
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 97.94
COG3523 1188 IcmF Type VI protein secretion system component Va 97.93
PF0685858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); Inte 97.89
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.84
PRK14723 767 flhF flagellar biosynthesis regulator FlhF; Provis 97.82
KOG1424562 consensus Predicted GTP-binding protein MMR1 [Gene 97.82
TIGR02475341 CobW cobalamin biosynthesis protein CobW. A broade 97.82
TIGR00959 428 ffh signal recognition particle protein. This mode 97.81
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.8
COG1162 301 Predicted GTPases [General function prediction onl 97.79
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 97.77
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 97.77
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 97.76
PRK10867 433 signal recognition particle protein; Provisional 97.75
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 97.73
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.68
KOG0780 483 consensus Signal recognition particle, subunit Srp 97.67
PRK00771 437 signal recognition particle protein Srp54; Provisi 97.67
COG3640255 CooC CO dehydrogenase maturation factor [Cell divi 97.65
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 97.64
PRK14737186 gmk guanylate kinase; Provisional 97.64
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.63
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 97.61
cd04178172 Nucleostemin_like Nucleostemin-like. Nucleostemin 97.61
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 97.6
PRK08118167 topology modulation protein; Reviewed 97.6
PF05729166 NACHT: NACHT domain 97.58
cd03111106 CpaE_like This protein family consists of proteins 97.57
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.57
cd02038139 FleN-like FleN is a member of the Fer4_NifH superf 97.56
PRK07261171 topology modulation protein; Provisional 97.54
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 97.53
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 97.53
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 97.53
COG1126240 GlnQ ABC-type polar amino acid transport system, A 97.52
PF1355562 AAA_29: P-loop containing region of AAA domain 97.48
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 97.46
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 97.46
KOG3347176 consensus Predicted nucleotide kinase/nuclear prot 97.45
PRK04195 482 replication factor C large subunit; Provisional 97.44
cd02042104 ParA ParA and ParB of Caulobacter crescentus belon 97.44
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 97.44
PF00005137 ABC_tran: ABC transporter This structure is on hol 97.42
PLN03025319 replication factor C subunit; Provisional 97.42
PHA00729226 NTP-binding motif containing protein 97.41
KOG0057591 consensus Mitochondrial Fe/S cluster exporter, ABC 97.41
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 97.41
COG1136226 SalX ABC-type antimicrobial peptide transport syst 97.4
PRK14530215 adenylate kinase; Provisional 97.37
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 97.36
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 97.36
KOG0781587 consensus Signal recognition particle receptor, al 97.35
PRK01889356 GTPase RsgA; Reviewed 97.35
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 97.34
KOG0066807 consensus eIF2-interacting protein ABC50 (ABC supe 97.34
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 97.34
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 97.34
KOG2484435 consensus GTPase [General function prediction only 97.31
KOG2484 435 consensus GTPase [General function prediction only 97.3
PRK06217183 hypothetical protein; Validated 97.3
PRK05480209 uridine/cytidine kinase; Provisional 97.3
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 97.29
COG4559259 ABC-type hemin transport system, ATPase component 97.29
PRK03839180 putative kinase; Provisional 97.27
cd02036179 MinD Bacterial cell division requires the formatio 97.26
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 97.26
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 97.26
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 97.26
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 97.25
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 97.25
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 97.24
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 97.24
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 97.24
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 97.24
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 97.24
COG0552340 FtsY Signal recognition particle GTPase [Intracell 97.24
COG1936180 Predicted nucleotide kinase (related to CMP and AM 97.23
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 97.23
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 97.23
TIGR00235207 udk uridine kinase. Model contains a number of lon 97.23
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 97.22
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 97.22
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 97.22
COG1161 322 Predicted GTPases [General function prediction onl 97.22
COG3638258 ABC-type phosphate/phosphonate transport system, A 97.21
PF00004132 AAA: ATPase family associated with various cellula 97.21
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 97.21
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 97.21
cd03269210 ABC_putative_ATPase This subfamily is involved in 97.21
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 97.21
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 97.21
>PLN00223 ADP-ribosylation factor; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.3e-33  Score=199.69  Aligned_cols=179  Identities=35%  Similarity=0.677  Sum_probs=145.2

Q ss_pred             ChhHHHHHHhhhcCCcccEEEEEcCCCCChHHHHHHHHhhccCCCCCCCCccccccceeeeEEEEeCcEEEEEEcCCCcc
Q 028750            1 MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPG   80 (204)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~i~v~G~~~~GKStli~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~g~~~   80 (204)
                      |+.++..++.....++.+||+++|..|||||||++++..      +... .+.+|.+.....+......+.+||+||++.
T Consensus         1 m~~~~~~~~~~~~~~~~~ki~ivG~~~~GKTsl~~~l~~------~~~~-~~~pt~g~~~~~~~~~~~~~~i~D~~Gq~~   73 (181)
T PLN00223          1 MGLSFTKLFSRLFAKKEMRILMVGLDAAGKTTILYKLKL------GEIV-TTIPTIGFNVETVEYKNISFTVWDVGGQDK   73 (181)
T ss_pred             CchHHHHHHHHhcCCCccEEEEECCCCCCHHHHHHHHcc------CCCc-cccCCcceeEEEEEECCEEEEEEECCCCHH
Confidence            555555554444567789999999999999999999953      1111 234666766666777888999999999999


Q ss_pred             hHHHHHHhcccCCEEEEEEeCCCCCCHHHHHHHHHHHHhcCCCCCCeEEEEEeCCCCCCccCHHHHHHHhCcccccccee
Q 028750           81 LRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVC  160 (204)
Q Consensus        81 ~~~~~~~~~~~~d~ii~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~p~ivv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~  160 (204)
                      +...+..+++++|++|+|+|+++++++.....++..++......++|+++|+||+|+.+....+++.+.++........+
T Consensus        74 ~~~~~~~~~~~a~~iI~V~D~s~~~s~~~~~~~l~~~l~~~~~~~~piilv~NK~Dl~~~~~~~~~~~~l~l~~~~~~~~  153 (181)
T PLN00223         74 IRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHW  153 (181)
T ss_pred             HHHHHHHHhccCCEEEEEEeCCcHHHHHHHHHHHHHHhcCHhhCCCCEEEEEECCCCCCCCCHHHHHHHhCccccCCCce
Confidence            99999999999999999999999999998888888877654446799999999999988888888888877544434455


Q ss_pred             EEEeecccCCCChHHHHHHHHHHHHh
Q 028750          161 MFEAVSGYDGFGIKESVEWLVEVMER  186 (204)
Q Consensus       161 ~~~~~Sa~~~~~v~~l~~~i~~~i~~  186 (204)
                      .++++||++|+|++++|++|.+.+..
T Consensus       154 ~~~~~Sa~~g~gv~e~~~~l~~~~~~  179 (181)
T PLN00223        154 YIQSTCATSGEGLYEGLDWLSNNIAN  179 (181)
T ss_pred             EEEeccCCCCCCHHHHHHHHHHHHhh
Confidence            67799999999999999999988754



>KOG0084 consensus GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>KOG0092 consensus GTPase Rab5/YPT51 and related small G protein superfamily GTPases [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04149 Arf6 Arf6 subfamily Back     alignment and domain information
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>cd04120 Rab12 Rab12 subfamily Back     alignment and domain information
>KOG0078 consensus GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0094 consensus GTPase Rab6/YPT6/Ryh1, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04158 ARD1 ARD1 subfamily Back     alignment and domain information
>cd04121 Rab40 Rab40 subfamily Back     alignment and domain information
>KOG0098 consensus GTPase Rab2, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily Back     alignment and domain information
>cd04133 Rop_like Rop subfamily Back     alignment and domain information
>smart00178 SAR Sar1p-like members of the Ras-family of small GTPases Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>PTZ00369 Ras-like protein; Provisional Back     alignment and domain information
>cd04127 Rab27A Rab27a subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>cd04126 Rab20 Rab20 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>KOG0080 consensus GTPase Rab18, small G protein superfamily [General function prediction only] Back     alignment and domain information
>KOG0076 consensus GTP-binding ADP-ribosylation factor-like protein yARL3 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd04151 Arl1 Arl1 subfamily Back     alignment and domain information
>cd04175 Rap1 Rap1 subgroup Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily Back     alignment and domain information
>cd04131 Rnd Rnd subfamily Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PLN03071 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily Back     alignment and domain information
>KOG0079 consensus GTP-binding protein H-ray, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>cd01865 Rab3 Rab3 subfamily Back     alignment and domain information
>KOG0075 consensus GTP-binding ADP-ribosylation factor-like protein [General function prediction only] Back     alignment and domain information
>cd01874 Cdc42 Cdc42 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>cd04110 Rab35 Rab35 subfamily Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>KOG0070 consensus GTP-binding ADP-ribosylation factor Arf1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04144 Ras2 Ras2 subfamily Back     alignment and domain information
>KOG0073 consensus GTP-binding ADP-ribosylation factor-like protein ARL2 [Intracellular trafficking, secretion, and vesicular transport; Cytoskeleton] Back     alignment and domain information
>cd01871 Rac1_like Rac1-like subfamily Back     alignment and domain information
>cd04109 Rab28 Rab28 subfamily Back     alignment and domain information
>KOG0093 consensus GTPase Rab3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>KOG0394 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04117 Rab15 Rab15 subfamily Back     alignment and domain information
>cd04111 Rab39 Rab39 subfamily Back     alignment and domain information
>cd04128 Spg1 Spg1p Back     alignment and domain information
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>cd04125 RabA_like RabA-like subfamily Back     alignment and domain information
>cd04106 Rab23_lke Rab23-like subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>KOG0095 consensus GTPase Rab30, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information
>PLN03110 Rab GTPase; Provisional Back     alignment and domain information
>cd04134 Rho3 Rho3 subfamily Back     alignment and domain information
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily Back     alignment and domain information
>KOG0086 consensus GTPase Rab4, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>PF00071 Ras: Ras family; InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd04132 Rho4_like Rho4-like subfamily Back     alignment and domain information
>cd04103 Centaurin_gamma Centaurin gamma Back     alignment and domain information
>cd04112 Rab26 Rab26 subfamily Back     alignment and domain information
>KOG0087 consensus GTPase Rab11/YPT3, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>cd04143 Rhes_like Rhes_like subfamily Back     alignment and domain information
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd04177 RSR1 RSR1 subgroup Back     alignment and domain information
>PLN03108 Rab family protein; Provisional Back     alignment and domain information
>cd04101 RabL4 RabL4 (Rab-like4) subfamily Back     alignment and domain information
>cd01873 RhoBTB RhoBTB subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04142 RRP22 RRP22 subfamily Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases Back     alignment and domain information
>cd04123 Rab21 Rab21 subfamily Back     alignment and domain information
>PLN03118 Rab family protein; Provisional Back     alignment and domain information
>cd04118 Rab24 Rab24 subfamily Back     alignment and domain information
>cd01892 Miro2 Miro2 subfamily Back     alignment and domain information
>cd04147 Ras_dva Ras-dva subfamily Back     alignment and domain information
>KOG0071 consensus GTP-binding ADP-ribosylation factor Arf6 (dArf3) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd04135 Tc10 TC10 subfamily Back     alignment and domain information
>cd04148 RGK RGK subfamily Back     alignment and domain information
>KOG0091 consensus GTPase Rab39, small G protein superfamily [General function prediction only] Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd01893 Miro1 Miro1 subfamily Back     alignment and domain information
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily Back     alignment and domain information
>cd01870 RhoA_like RhoA-like subfamily Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>KOG0088 consensus GTPase Rab21, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans Back     alignment and domain information
>KOG0395 consensus Ras-related GTPase [General function prediction only] Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>KOG0081 consensus GTPase Rab27, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01898 Obg Obg subfamily Back     alignment and domain information
>cd04171 SelB SelB subfamily Back     alignment and domain information
>PRK12299 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>KOG0097 consensus GTPase Rab14, small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0074 consensus GTP-binding ADP-ribosylation factor-like protein ARL3 [General function prediction only] Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>PF00009 GTP_EFTU: Elongation factor Tu GTP binding domain; InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site Back     alignment and domain information
>TIGR02729 Obg_CgtA Obg family GTPase CgtA Back     alignment and domain information
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily Back     alignment and domain information
>KOG0072 consensus GTP-binding ADP-ribosylation factor-like protein ARL1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0083 consensus GTPase Rab26/Rab37, small G protein superfamily [General function prediction only] Back     alignment and domain information
>PF02421 FeoB_N: Ferrous iron transport protein B; InterPro: IPR011619 Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions Back     alignment and domain information
>TIGR03156 GTP_HflX GTP-binding protein HflX Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>cd00881 GTP_translation_factor GTP translation factor family Back     alignment and domain information
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2) Back     alignment and domain information
>cd01889 SelB_euk SelB subfamily Back     alignment and domain information
>TIGR02528 EutP ethanolamine utilization protein, EutP Back     alignment and domain information
>PRK15494 era GTPase Era; Provisional Back     alignment and domain information
>TIGR00436 era GTP-binding protein Era Back     alignment and domain information
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes Back     alignment and domain information
>KOG4252 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK04213 GTP-binding protein; Provisional Back     alignment and domain information
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1 Back     alignment and domain information
>PRK12296 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily Back     alignment and domain information
>cd01895 EngA2 EngA2 subfamily Back     alignment and domain information
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed Back     alignment and domain information
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily Back     alignment and domain information
>PRK12297 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PLN00023 GTP-binding protein; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>PRK03003 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK15467 ethanolamine utilization protein EutP; Provisional Back     alignment and domain information
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE Back     alignment and domain information
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only] Back     alignment and domain information
>COG2229 Predicted GTPase [General function prediction only] Back     alignment and domain information
>PTZ00099 rab6; Provisional Back     alignment and domain information
>cd01894 EngA1 EngA1 subfamily Back     alignment and domain information
>KOG0393 consensus Ras-related small GTPase, Rho type [General function prediction only] Back     alignment and domain information
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta) Back     alignment and domain information
>PRK11058 GTPase HflX; Provisional Back     alignment and domain information
>TIGR01393 lepA GTP-binding protein LepA Back     alignment and domain information
>COG1159 Era GTPase [General function prediction only] Back     alignment and domain information
>PRK12298 obgE GTPase CgtA; Reviewed Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK00454 engB GTP-binding protein YsxC; Reviewed Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha Back     alignment and domain information
>TIGR00487 IF-2 translation initiation factor IF-2 Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00475 selB selenocysteine-specific elongation factor SelB Back     alignment and domain information
>PRK12317 elongation factor 1-alpha; Reviewed Back     alignment and domain information
>cd01884 EF_Tu EF-Tu subfamily Back     alignment and domain information
>PRK05306 infB translation initiation factor IF-2; Validated Back     alignment and domain information
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB Back     alignment and domain information
>PRK00093 GTP-binding protein Der; Reviewed Back     alignment and domain information
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated Back     alignment and domain information
>PRK00089 era GTPase Era; Reviewed Back     alignment and domain information
>cd00880 Era_like Era (E Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK05433 GTP-binding protein LepA; Provisional Back     alignment and domain information
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins Back     alignment and domain information
>CHL00189 infB translation initiation factor 2; Provisional Back     alignment and domain information
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA Back     alignment and domain information
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd04166 CysN_ATPS CysN_ATPS subfamily Back     alignment and domain information
>COG1160 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA Back     alignment and domain information
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily Back     alignment and domain information
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed Back     alignment and domain information
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2 Back     alignment and domain information
>PRK10218 GTP-binding protein; Provisional Back     alignment and domain information
>COG0218 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG0486 ThdF Predicted GTPase [General function prediction only] Back     alignment and domain information
>PRK09554 feoB ferrous iron transport protein B; Reviewed Back     alignment and domain information
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional Back     alignment and domain information
>KOG3883 consensus Ras family small GTPase [Signal transduction mechanisms] Back     alignment and domain information
>PRK12736 elongation factor Tu; Reviewed Back     alignment and domain information
>KOG1489 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>cd04165 GTPBP1_like GTPBP1-like Back     alignment and domain information
>PRK04004 translation initiation factor IF-2; Validated Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>TIGR00437 feoB ferrous iron transporter FeoB Back     alignment and domain information
>PRK12735 elongation factor Tu; Reviewed Back     alignment and domain information
>CHL00071 tufA elongation factor Tu Back     alignment and domain information
>COG1163 DRG Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1084 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG2262 HflX GTPases [General function prediction only] Back     alignment and domain information
>PLN00043 elongation factor 1-alpha; Provisional Back     alignment and domain information
>TIGR00485 EF-Tu translation elongation factor TU Back     alignment and domain information
>cd04167 Snu114p Snu114p subfamily Back     alignment and domain information
>KOG0077 consensus Vesicle coat complex COPII, GTPase subunit SAR1 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01885 EF2 EF2 (for archaea and eukarya) Back     alignment and domain information
>PRK00049 elongation factor Tu; Reviewed Back     alignment and domain information
>PLN03126 Elongation factor Tu; Provisional Back     alignment and domain information
>cd01876 YihA_EngB The YihA (EngB) subfamily Back     alignment and domain information
>PLN03127 Elongation factor Tu; Provisional Back     alignment and domain information
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional Back     alignment and domain information
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional Back     alignment and domain information
>cd04104 p47_IIGP_like p47 (47-kDa) family Back     alignment and domain information
>PTZ00141 elongation factor 1- alpha; Provisional Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02034 CysN sulfate adenylyltransferase, large subunit Back     alignment and domain information
>PRK13351 elongation factor G; Reviewed Back     alignment and domain information
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information
>KOG0096 consensus GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00741 prfC peptide chain release factor 3; Provisional Back     alignment and domain information
>COG0536 Obg Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG0462 consensus Elongation factor-type GTP-binding protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0090 consensus Signal recognition particle receptor, beta subunit (small G protein superfamily) [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR00503 prfC peptide chain release factor 3 Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>PF04670 Gtr1_RagA: Gtr1/RagA G protein conserved region; InterPro: IPR006762 GTR1 was first identified in Saccharomyces cerevisiae (Baker's yeast) as a suppressor of a mutation in RCC1 Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>KOG1673 consensus Ras GTPases [General function prediction only] Back     alignment and domain information
>KOG1423 consensus Ras-like GTPase ERA [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG1145 consensus Mitochondrial translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00484 EF-G translation elongation factor EF-G Back     alignment and domain information
>PRK12739 elongation factor G; Reviewed Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>PRK00007 elongation factor G; Reviewed Back     alignment and domain information
>cd01899 Ygr210 Ygr210 subfamily Back     alignment and domain information
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1) Back     alignment and domain information
>KOG1191 consensus Mitochondrial GTPase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09866 hypothetical protein; Provisional Back     alignment and domain information
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4423 consensus GTP-binding protein-like, RAS superfamily [Signal transduction mechanisms] Back     alignment and domain information
>cd00066 G-alpha G protein alpha subunit Back     alignment and domain information
>COG0050 TufB GTPases - translation elongation factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00275 G_alpha G protein alpha subunit Back     alignment and domain information
>PRK12740 elongation factor G; Reviewed Back     alignment and domain information
>COG5257 GCD11 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09602 translation-associated GTPase; Reviewed Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG2895 CysN GTPases - Sulfate adenylate transferase subunit 1 [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3596 Predicted GTPase [General function prediction only] Back     alignment and domain information
>COG1217 TypA Predicted membrane GTPase involved in stress response [Signal transduction mechanisms] Back     alignment and domain information
>KOG1532 consensus GTPase XAB1, interacts with DNA repair protein XPA [Replication, recombination and repair] Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1490 consensus GTP-binding protein CRFG/NOG1 (ODN superfamily) [General function prediction only] Back     alignment and domain information
>KOG0458 consensus Elongation factor 1 alpha [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01850 CDC_Septin CDC/Septin Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK14845 translation initiation factor IF-2; Provisional Back     alignment and domain information
>PRK07560 elongation factor EF-2; Reviewed Back     alignment and domain information
>TIGR00490 aEF-2 translation elongation factor aEF-2 Back     alignment and domain information
>PF04548 AIG1: AIG1 family; InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria Back     alignment and domain information
>PF05049 IIGP: Interferon-inducible GTPase (IIGP); InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence Back     alignment and domain information
>cd01882 BMS1 Bms1 Back     alignment and domain information
>PTZ00416 elongation factor 2; Provisional Back     alignment and domain information
>KOG0082 consensus G-protein alpha subunit (small G protein superfamily) [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms] Back     alignment and domain information
>KOG0461 consensus Selenocysteine-specific elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00116 translation elongation factor EF-2 subunit; Provisional Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>PTZ00258 GTP-binding protein; Provisional Back     alignment and domain information
>COG4108 PrfC Peptide chain release factor RF-3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00101 ureG urease accessory protein UreG Back     alignment and domain information
>KOG0460 consensus Mitochondrial translation elongation factor Tu [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG1144 consensus Translation initiation factor 5B (eIF-5B) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>TIGR00073 hypB hydrogenase accessory protein HypB Back     alignment and domain information
>PRK09601 GTP-binding protein YchF; Reviewed Back     alignment and domain information
>KOG1486 consensus GTP-binding protein DRG2 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0410 consensus Predicted GTP binding protein [General function prediction only] Back     alignment and domain information
>TIGR02836 spore_IV_A stage IV sporulation protein A Back     alignment and domain information
>smart00053 DYNc Dynamin, GTPase Back     alignment and domain information
>KOG3905 consensus Dynein light intermediate chain [Cell motility] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PF00350 Dynamin_N: Dynamin family; InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another Back     alignment and domain information
>PF00503 G-alpha: G-protein alpha subunit; InterPro: IPR001019 Guanine nucleotide binding proteins (G proteins) are membrane-associated, heterotrimeric proteins composed of three subunits: alpha (IPR001019 from INTERPRO), beta (IPR001632 from INTERPRO) and gamma (IPR001770 from INTERPRO) [] Back     alignment and domain information
>KOG1487 consensus GTP-binding protein DRG1 (ODN superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>KOG1707 consensus Predicted Ras related/Rac-GTP binding protein [Defense mechanisms] Back     alignment and domain information
>PF00735 Septin: Septin; InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments [] Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00010 small_GTPase Small GTPase of the Ras superfamily; ill-defined subfamily Back     alignment and domain information
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains Back     alignment and domain information
>KOG0085 consensus G protein subunit Galphaq/Galphay, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>PF05783 DLIC: Dynein light intermediate chain (DLIC); InterPro: IPR022780 This entry consists of several eukaryotic dynein light intermediate chain proteins Back     alignment and domain information
>COG5258 GTPBP1 GTPase [General function prediction only] Back     alignment and domain information
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3887 consensus Predicted small GTPase involved in nuclear protein import [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>cd01900 YchF YchF subfamily Back     alignment and domain information
>KOG0466 consensus Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0705 consensus GTPase-activating protein Centaurin gamma (contains Ras-like GTPase, PH and ankyrin repeat domains) [Signal transduction mechanisms] Back     alignment and domain information
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton] Back     alignment and domain information
>KOG0099 consensus G protein subunit Galphas, small G protein superfamily [Signal transduction mechanisms] Back     alignment and domain information
>KOG3886 consensus GTP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG2655 consensus Septin family protein (P-loop GTPase) [Cell cycle control, cell division, chromosome partitioning; Cytoskeleton; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>KOG0447 consensus Dynamin-like GTP binding protein [General function prediction only] Back     alignment and domain information
>KOG2486 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG1547 consensus Septin CDC10 and related P-loop GTPases [Cell cycle control, cell division, chromosome partitioning; Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG0459 consensus Polypeptide release factor 3 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG1143 consensus Predicted translation elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>COG5192 BMS1 GTP-binding protein required for 40S ribosome biogenesis [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01858 NGP_1 NGP-1 Back     alignment and domain information
>TIGR00092 GTP-binding protein YchF Back     alignment and domain information
>KOG0467 consensus Translation elongation factor 2/ribosome biogenesis protein RIA1 and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>KOG1954 consensus Endocytosis/signaling protein EHD1 [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>cd01855 YqeH YqeH Back     alignment and domain information
>KOG0465 consensus Mitochondrial elongation factor [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG0464 consensus Elongation factor G [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01857 HSR1_MMR1 HSR1/MMR1 Back     alignment and domain information
>KOG1534 consensus Putative transcription factor FET5 [Transcription] Back     alignment and domain information
>KOG1491 consensus Predicted GTP-binding protein (ODN superfamily) [General function prediction only] Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>TIGR03348 VI_IcmF type VI secretion protein IcmF Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>cd01849 YlqF_related_GTPase YlqF-related GTPases Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain Back     alignment and domain information
>PF09547 Spore_IV_A: Stage IV sporulation protein A (spore_IV_A); InterPro: IPR014201 This entry is designated stage IV sporulation protein A Back     alignment and domain information
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF Back     alignment and domain information
>KOG0448 consensus Mitofusin 1 GTPase, involved in mitochondrila biogenesis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>cd01856 YlqF YlqF Back     alignment and domain information
>PRK12288 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK09563 rbgA GTPase YlqF; Reviewed Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR00157 ribosome small subunit-dependent GTPase A Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>cd01859 MJ1464 MJ1464 Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>PRK12289 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG0463 consensus GTP-binding protein GP-1 [General function prediction only] Back     alignment and domain information
>cd01854 YjeQ_engC YjeQ/EngC Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK13796 GTPase YqeH; Provisional Back     alignment and domain information
>KOG3859 consensus Septins (P-loop GTPases) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>KOG1533 consensus Predicted GTPase [General function prediction only] Back     alignment and domain information
>KOG2485 consensus Conserved ATP/GTP binding protein [General function prediction only] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>KOG2423 consensus Nucleolar GTPase [General function prediction only] Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>KOG0469 consensus Elongation factor 2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF06858 NOG1: Nucleolar GTP-binding protein 1 (NOG1); InterPro: IPR010674 This domain represents a conserved region of approximately 60 residues in length within nucleolar GTP-binding protein 1 (NOG1) Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG1424 consensus Predicted GTP-binding protein MMR1 [General function prediction only] Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG1162 Predicted GTPases [General function prediction only] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG0780 consensus Signal recognition particle, subunit Srp54 [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd04178 Nucleostemin_like Nucleostemin-like Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>KOG3347 consensus Predicted nucleotide kinase/nuclear protein involved oxidative stress response [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>KOG0057 consensus Mitochondrial Fe/S cluster exporter, ABC superfamily [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>KOG0781 consensus Signal recognition particle receptor, alpha subunit [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>PRK01889 GTPase RsgA; Reviewed Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>KOG0066 consensus eIF2-interacting protein ABC50 (ABC superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>KOG2484 consensus GTPase [General function prediction only] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases) [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>COG1161 Predicted GTPases [General function prediction only] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
1moz_A183 Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharo 2e-30
1rrg_A181 Non-Myristoylated Rat Adp-Ribosylation Factor-1 Com 8e-30
2k5u_A181 Solution Structure Of Myirstoylated Yeast Arf1 Prot 1e-29
1hur_A180 Human Adp-Ribosylation Factor 1 Complexed With Gdp, 2e-29
3lrp_A181 Crystal Structure Of Plasmodium Falciparum Adp-Ribo 4e-29
1mr3_F181 Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 5e-29
2ksq_A181 The Myristoylated Yeast Arf1 In A Gtp And Bicelle B 6e-29
2b6h_A192 Structure Of Human Adp-Ribosylation Factor 5 Length 6e-29
3tjz_A164 Crystal Structure Of Arf1 Bound To The GammaZETA-Co 3e-28
3aq4_A184 Molecular Insights Into Plant Cell Proliferation Di 3e-28
2a5d_A175 Structural Basis For The Activation Of Cholera Toxi 5e-28
1e0s_A174 Small G Protein Arf6-Gdp Length = 174 5e-28
3doe_A192 Complex Of Arl2 And Bart, Crystal Form 1 Length = 1 7e-28
1z6y_A179 Structure Of Human Adp-Ribosylation Factor-Like 5 L 7e-28
1zj6_A187 Crystal Structure Of Human Arl5 Length = 187 7e-28
1z6x_A180 Structure Of Human Adp-Ribosylation Factor 4 Length 9e-28
3o47_A329 Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le 9e-28
1ksg_A186 Complex Of Arl2 And Pde Delta, Crystal Form 1 Lengt 1e-27
1ksh_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Nati 2e-27
1r4a_A165 Crystal Structure Of Gtp-Bound Adp-Ribosylation Fac 3e-27
2a5g_A175 Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length 4e-27
3lvr_E497 The Crystal Structure Of Asap3 In Complex With Arf6 6e-27
1yzg_A179 Structure Of Human Adp-ribosylation Factor-like 8 L 7e-27
2h18_A193 Structure Of Human Adp-Ribosylation Factor-Like 10b 8e-27
4dcn_A166 Crystal Structure Analysis Of The Arfaptin2 Bar Dom 1e-26
3n5c_A162 Crystal Structure Of Arf6delta13 Complexed With Gdp 2e-26
4fme_C160 Espg-Rab1-Arf6 Complex Length = 160 2e-26
3rd1_A178 Structure Of An Adp Ribosylation Factor From Entamo 2e-26
1zd9_A188 Structure Of Human Adp-Ribosylation Factor-Like 10b 2e-26
1re0_A164 Structure Of Arf1-Gdp Bound To Sec7 Domain Complexe 3e-26
2w83_A165 Crystal Structure Of The Arf6 Gtpase In Complex Wit 4e-26
3vhx_A172 The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesi 4e-26
4gok_B169 The Crystal Structure Of Arl2gppnhp In Complex With 5e-26
2al7_A186 Structure Of Human Adp-Ribosylation Factor-Like 10c 5e-26
2h17_A181 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 9e-26
2h16_A183 Structure Of Human Adp-Ribosylation Factor-Like 5 ( 1e-25
4goj_A189 The Crystal Structure Of Full Length Arl3gppnhp In 1e-25
1fzq_A181 Crystal Structure Of Murine Arl3-Gdp Length = 181 1e-25
3pcr_B162 Structure Of Espg-Arf6 Complex Length = 162 2e-25
3bh7_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 2e-25
1j2j_A166 Crystal Structure Of Gga1 Gat N-terminal Region In 3e-25
2h57_A190 Crystal Structure Of Human Adp-Ribosylation Factor- 5e-25
1ksj_A186 Complex Of Arl2 And Pde Delta, Crystal Form 2 (Seme 1e-24
3bh6_A164 Crystal Structure Of The Rp2-Arl3 Complex Bound To 2e-24
1upt_A171 Structure Of A Complex Of The Golgin-245 Grip Domai 1e-22
4bas_A199 Structure Of The Arl6 Bbs3 Small Gtpase From Trypan 3e-22
2x77_A189 Crystal Structure Of Leishmania Major Adp Ribosylat 1e-20
2qtv_B167 Structure Of Sec23-Sar1 Complexed With The Active F 1e-18
1m2o_B190 Crystal Structure Of The Sec23-Sar1 Complex Length 1e-18
2gao_A208 Crystal Structure Of Human Sar1a In Complex With Gd 7e-16
2fmx_A195 An Open Conformation Of Switch I Revealed By Sar1-g 1e-15
1f6b_A198 Crystal Structure Of Sar1-Gdp Complex Length = 198 1e-15
2fa9_A189 The Crystal Structure Of Sar1[h79g]-gdp Provides In 3e-15
2g77_B198 Crystal Structure Of Gyp1 Tbc Domain In Complex Wit 1e-08
1z06_A189 Gppnhp-Bound Rab33 Gtpase Length = 189 1e-08
2rhd_A175 Crystal Structure Of Cryptosporidium Parvum Small G 8e-08
3tw8_B181 Gef Domain Of Dennd 1b In Complex With Rab Gtpase R 2e-07
2g6b_A180 Crystal Structure Of Human Rab26 In Complex With A 3e-07
3rab_A169 Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 6e-07
2ew1_A201 Crystal Structure Of Rab30 In Complex With A Gtp An 7e-07
4fmc_B171 Espg-Rab1 Complex Length = 171 9e-07
4fmb_B171 Vira-Rab1 Complex Structure Length = 171 9e-07
2fol_A191 Crystal Structure Of Human Rab1a In Complex With Gd 1e-06
3l0i_B199 Complex Structure Of Sidm/drra With The Wild Type R 1e-06
1yzn_A185 Gppnhp-Bound Ypt1p Gtpase Length = 185 1e-06
2bcg_Y206 Structure Of Doubly Prenylated Ypt1:gdi Complex Len 1e-06
1ukv_Y206 Structure Of Rabgdp-Dissociation Inhibitor In Compl 1e-06
3sfv_A181 Crystal Structure Of The Gdp-Bound Rab1a S25n Mutan 1e-06
3tkl_A196 Crystal Structure Of The Gtp-Bound Rab1a In Complex 1e-06
3jza_A175 Crystal Structure Of Human Rab1b In Complex With Th 1e-06
4i1o_A181 Crystal Structure Of The Legionella Pneumophila Gap 1e-06
1yzq_A170 Gppnhp-Bound Rab6 Gtpase Length = 170 3e-06
4fmd_F164 Espg-Rab1 Complex Structure At 3.05 A Length = 164 4e-06
2gil_A162 Structure Of The Extremely Slow Gtpase Rab6a In The 4e-06
2y8e_A179 Crystal Structure Of D. Melanogaster Rab6 Gtpase Bo 5e-06
3bfk_A181 Crystal Structure Of Plasmodium Falciparum Rab11a I 7e-06
4fmc_F117 Espg-Rab1 Complex Length = 117 8e-06
3rwm_B185 Crystal Structure Of Ypt32 In Complex With Gppnhp L 1e-05
2hup_A201 Crystal Structure Of Human Rab43 In Complex With Gd 1e-05
2wwx_A175 Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Ra 2e-05
2f7s_A217 The Crystal Structure Of Human Rab27b Bound To Gdp 2e-05
3cph_A213 Crystal Structure Of Sec4 In Complex With Rab-Gdi L 2e-05
2p5s_A199 Rab Domain Of Human Rasef In Complex With Gdp Lengt 2e-05
2fe4_A171 The Crystal Structure Of Human Neuronal Rab6b In It 2e-05
1zbd_A203 Structural Basis Of Rab Effector Specificity: Cryst 3e-05
2gf9_A189 Crystal Structure Of Human Rab3d In Complex With Gd 3e-05
4epr_A170 Discovery Of Small Molecules That Bind To K-Ras And 3e-05
2eqb_A174 Crystal Structure Of The Rab Gtpase Sec4p, The Sec2 3e-05
2fu5_C183 Structure Of Rab8 In Complex With Mss4 Length = 183 3e-05
3qbt_A174 Crystal Structure Of Ocrl1 540-678 In Complex With 4e-05
1g17_A170 Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma) 4e-05
1ky2_A182 Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 4e-05
1gua_A167 Human Rap1a, Residues 1-167, Double Mutant (E30d,K3 5e-05
4dso_A189 Small-Molecule Ligands Bind To A Distinct Pocket In 5e-05
2il1_A192 Crystal Structure Of A Predicted Human Gtpase In Co 5e-05
4dkx_A216 Crystal Structure Of The Rab 6a'(Q72l) Length = 216 7e-05
1d5c_A162 Crystal Structure Of Plasmodium Falciparum Rab6 Com 7e-05
2ocy_C170 Complex Of The Guanine Exchange Factor Sec2p And Th 7e-05
1z08_A170 Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 7e-05
3cwz_A188 Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 7e-05
2bmd_A186 High Resolution Structure Of Gdp-Bound Human Rab4a 9e-05
1n6o_A170 Crystal Structure Of Human Rab5a A30k Mutant Comple 9e-05
1c1y_A167 Crystal Structure Of Rap.Gmppnp In Complex With The 9e-05
3cpj_B223 Crystal Structure Of Ypt31 In Complex With Yeast Ra 9e-05
2if0_A200 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 1e-04
1z0a_A174 Gdp-Bound Rab2a Gtpase Length = 174 1e-04
1g16_A170 Crystal Structure Of Sec4-Gdp Length = 170 1e-04
1vg1_A185 Gdp-bound Rab7 Length = 185 1e-04
2fh5_B214 The Structure Of The Mammalian Srp Receptor Length 1e-04
2efc_B181 Ara7-GdpATVPS9A Length = 181 1e-04
1vg0_B207 The Crystal Structures Of The Rep-1 Protein In Comp 2e-04
2a5j_A191 Crystal Structure Of Human Rab2b Length = 191 2e-04
3bbp_A211 Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 2e-04
1n6n_A170 Crystal Structure Of Human Rab5a A30r Mutant Comple 2e-04
2iez_A220 Crystal Structure Of Mouse Rab27b Bound To Gdp In M 2e-04
1yu9_A175 Gppnhp-Bound Rab4a Length = 175 2e-04
1oiv_A191 X-Ray Structure Of The Small G Protein Rab11a In Co 2e-04
3brw_D167 Structure Of The Rap-Rapgap Complex Length = 167 2e-04
1yzk_A184 Gppnhp Bound Rab11 Gtpase Length = 184 2e-04
2f9l_A199 3d Structure Of Inactive Human Rab11b Gtpase Length 3e-04
1n6p_A170 Crystal Structure Of Human Rab5a A30e Mutant Comple 3e-04
3law_A207 Structure Of Gtp-Bound L129f Mutant Rab7 Length = 2 3e-04
1tu4_A171 Crystal Structure Of Rab5-Gdp Complex Length = 171 4e-04
4dxa_A169 Co-Crystal Structure Of Rap1 In Complex With Krit1 4e-04
1z22_A168 Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Spac 4e-04
1tu3_A171 Crystal Structure Of Rab5 Complex With Rabaptin5 C- 4e-04
2iey_A195 Crystal Structure Of Mouse Rab27b Bound To Gdp In H 4e-04
1yzu_A170 Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Leng 4e-04
1n6h_A170 Crystal Structure Of Human Rab5a Length = 170 4e-04
1yzt_A184 Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Leng 5e-04
2hei_A179 Crystal Structure Of Human Rab5b In Complex With Gd 5e-04
1n6i_A170 Crystal Structure Of Human Rab5a A30p Mutant Comple 6e-04
2zet_A203 Crystal Structure Of The Small Gtpase Rab27b Comple 6e-04
1yvd_A169 Gppnhp-Bound Rab22 Gtpase Length = 169 7e-04
1z07_A166 Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 7e-04
1n6r_A170 Crystal Structure Of Human Rab5a A30l Mutant Comple 7e-04
>pdb|1MOZ|A Chain A, Adp-Ribosylation Factor-Like 1 (Arl1) From Saccharomyces Cerevisiae Length = 183 Back     alignment and structure

Iteration: 1

Score = 128 bits (321), Expect = 2e-30, Method: Compositional matrix adjust. Identities = 71/186 (38%), Positives = 108/186 (58%), Gaps = 10/186 (5%) Query: 3 SLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGR 62 S+F LW + E +LILG+D AGKTT+L +L+ + + + PT+G N+ Sbjct: 7 SMFDKLWG---SNKELRILILGLDGAGKTTILYRLQ-----IGEVVTTK--PTIGFNVET 56 Query: 63 IEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNED 122 + N KL WDLGGQ +R W YY + AV+FV+D+ R + L +L+ E+ Sbjct: 57 LSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEE 116 Query: 123 LQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVE 182 LQ A LL+ ANKQD P A+SA E+++ L+L +L +R A S G GI E ++WL++ Sbjct: 117 LQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLID 176 Query: 183 VMERSK 188 V++ + Sbjct: 177 VIKEEQ 182
>pdb|1RRG|A Chain A, Non-Myristoylated Rat Adp-Ribosylation Factor-1 Complexed With Gdp, Dimeric Crystal Form Length = 181 Back     alignment and structure
>pdb|2K5U|A Chain A, Solution Structure Of Myirstoylated Yeast Arf1 Protein, Gdp- Bound Length = 181 Back     alignment and structure
>pdb|1HUR|A Chain A, Human Adp-Ribosylation Factor 1 Complexed With Gdp, Full Length = 180 Back     alignment and structure
>pdb|3LRP|A Chain A, Crystal Structure Of Plasmodium Falciparum Adp-Ribosylation Factor 1 Length = 181 Back     alignment and structure
>pdb|1MR3|F Chain F, Saccharomyces Cerevisiae Adp-Ribosylation Factor 2 (Scarf2) Complexed With Gdp-3'p At 1.6a Resolution Length = 181 Back     alignment and structure
>pdb|2KSQ|A Chain A, The Myristoylated Yeast Arf1 In A Gtp And Bicelle Bound Conformation Length = 181 Back     alignment and structure
>pdb|2B6H|A Chain A, Structure Of Human Adp-Ribosylation Factor 5 Length = 192 Back     alignment and structure
>pdb|3TJZ|A Chain A, Crystal Structure Of Arf1 Bound To The GammaZETA-Cop Core Complex Length = 164 Back     alignment and structure
>pdb|3AQ4|A Chain A, Molecular Insights Into Plant Cell Proliferation Disturbance By Agrobacterium Protein 6b Length = 184 Back     alignment and structure
>pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By Human Arf6-Gtp Length = 175 Back     alignment and structure
>pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp Length = 174 Back     alignment and structure
>pdb|3DOE|A Chain A, Complex Of Arl2 And Bart, Crystal Form 1 Length = 192 Back     alignment and structure
>pdb|1Z6Y|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 Length = 179 Back     alignment and structure
>pdb|1ZJ6|A Chain A, Crystal Structure Of Human Arl5 Length = 187 Back     alignment and structure
>pdb|1Z6X|A Chain A, Structure Of Human Adp-Ribosylation Factor 4 Length = 180 Back     alignment and structure
>pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 Back     alignment and structure
>pdb|1KSG|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 1 Length = 186 Back     alignment and structure
>pdb|1KSH|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Native) Length = 186 Back     alignment and structure
>pdb|1R4A|A Chain A, Crystal Structure Of Gtp-Bound Adp-Ribosylation Factor Like Protein 1 (Arl1) And Grip Domain Of Golgin245 Complex Length = 165 Back     alignment and structure
>pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l) Length = 175 Back     alignment and structure
>pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Soaked With Calcium Length = 497 Back     alignment and structure
>pdb|1YZG|A Chain A, Structure Of Human Adp-ribosylation Factor-like 8 Length = 179 Back     alignment and structure
>pdb|2H18|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b (Arl10b) Length = 193 Back     alignment and structure
>pdb|4DCN|A Chain A, Crystal Structure Analysis Of The Arfaptin2 Bar Domain In Complex With Arl1 Length = 166 Back     alignment and structure
>pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex Length = 160 Back     alignment and structure
>pdb|3RD1|A Chain A, Structure Of An Adp Ribosylation Factor From Entamoeba Histolytica Hm- 1:imss Bound To Mg-Gdp Length = 178 Back     alignment and structure
>pdb|1ZD9|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10b Length = 188 Back     alignment and structure
>pdb|1RE0|A Chain A, Structure Of Arf1-Gdp Bound To Sec7 Domain Complexed With Brefeldin A Length = 164 Back     alignment and structure
>pdb|2W83|A Chain A, Crystal Structure Of The Arf6 Gtpase In Complex With A Specific Effector, Jip4 Length = 165 Back     alignment and structure
>pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-Mklp1 (Mitotic Kinesin-Like Protein 1) Complex Length = 172 Back     alignment and structure
>pdb|4GOK|B Chain B, The Crystal Structure Of Arl2gppnhp In Complex With Unc119a Length = 169 Back     alignment and structure
>pdb|2AL7|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 10c Length = 186 Back     alignment and structure
>pdb|2H17|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) (Casp Target) Length = 181 Back     alignment and structure
>pdb|2H16|A Chain A, Structure Of Human Adp-Ribosylation Factor-Like 5 (Arl5) Length = 183 Back     alignment and structure
>pdb|4GOJ|A Chain A, The Crystal Structure Of Full Length Arl3gppnhp In Complex With Unc119a Length = 189 Back     alignment and structure
>pdb|1FZQ|A Chain A, Crystal Structure Of Murine Arl3-Gdp Length = 181 Back     alignment and structure
>pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex Length = 162 Back     alignment and structure
>pdb|3BH7|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gdp-Alf4 Length = 164 Back     alignment and structure
>pdb|1J2J|A Chain A, Crystal Structure Of Gga1 Gat N-terminal Region In Complex With Arf1 Gtp Form Length = 166 Back     alignment and structure
>pdb|2H57|A Chain A, Crystal Structure Of Human Adp-Ribosylation Factor-Like 6 Length = 190 Back     alignment and structure
>pdb|1KSJ|A Chain A, Complex Of Arl2 And Pde Delta, Crystal Form 2 (Semet) Length = 186 Back     alignment and structure
>pdb|3BH6|A Chain A, Crystal Structure Of The Rp2-Arl3 Complex Bound To Gppnhp Length = 164 Back     alignment and structure
>pdb|1UPT|A Chain A, Structure Of A Complex Of The Golgin-245 Grip Domain With Arl1 Length = 171 Back     alignment and structure
>pdb|4BAS|A Chain A, Structure Of The Arl6 Bbs3 Small Gtpase From Trypanosoma Brucei With Bound Nucleotide Analogue Gppnp Length = 199 Back     alignment and structure
>pdb|2X77|A Chain A, Crystal Structure Of Leishmania Major Adp Ribosylation Factor-Like 1. Length = 189 Back     alignment and structure
>pdb|2QTV|B Chain B, Structure Of Sec23-Sar1 Complexed With The Active Fragment Of Sec31 Length = 167 Back     alignment and structure
>pdb|1M2O|B Chain B, Crystal Structure Of The Sec23-Sar1 Complex Length = 190 Back     alignment and structure
>pdb|2GAO|A Chain A, Crystal Structure Of Human Sar1a In Complex With Gdp Length = 208 Back     alignment and structure
>pdb|2FMX|A Chain A, An Open Conformation Of Switch I Revealed By Sar1-gdp Crystal Structure At Low Mg(2+) Length = 195 Back     alignment and structure
>pdb|1F6B|A Chain A, Crystal Structure Of Sar1-Gdp Complex Length = 198 Back     alignment and structure
>pdb|2FA9|A Chain A, The Crystal Structure Of Sar1[h79g]-gdp Provides Insight Into The Coat-controlled Gtp Hydrolysis In The Disassembly Of Cop Ii Length = 189 Back     alignment and structure
>pdb|2G77|B Chain B, Crystal Structure Of Gyp1 Tbc Domain In Complex With Rab33 Gtpase Bound To Gdp And Alf3 Length = 198 Back     alignment and structure
>pdb|1Z06|A Chain A, Gppnhp-Bound Rab33 Gtpase Length = 189 Back     alignment and structure
>pdb|2RHD|A Chain A, Crystal Structure Of Cryptosporidium Parvum Small Gtpase Rab1a Length = 175 Back     alignment and structure
>pdb|3TW8|B Chain B, Gef Domain Of Dennd 1b In Complex With Rab Gtpase Rab35 Length = 181 Back     alignment and structure
>pdb|2G6B|A Chain A, Crystal Structure Of Human Rab26 In Complex With A Gtp Analogue Length = 180 Back     alignment and structure
>pdb|3RAB|A Chain A, Gppnhp-bound Rab3a At 2.0 A Resolution Length = 169 Back     alignment and structure
>pdb|2EW1|A Chain A, Crystal Structure Of Rab30 In Complex With A Gtp Analogue Length = 201 Back     alignment and structure
>pdb|4FMC|B Chain B, Espg-Rab1 Complex Length = 171 Back     alignment and structure
>pdb|4FMB|B Chain B, Vira-Rab1 Complex Structure Length = 171 Back     alignment and structure
>pdb|2FOL|A Chain A, Crystal Structure Of Human Rab1a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3L0I|B Chain B, Complex Structure Of Sidm/drra With The Wild Type Rab1 Length = 199 Back     alignment and structure
>pdb|1YZN|A Chain A, Gppnhp-Bound Ypt1p Gtpase Length = 185 Back     alignment and structure
>pdb|2BCG|Y Chain Y, Structure Of Doubly Prenylated Ypt1:gdi Complex Length = 206 Back     alignment and structure
>pdb|1UKV|Y Chain Y, Structure Of Rabgdp-Dissociation Inhibitor In Complex With Prenylated Ypt1 Gtpase Length = 206 Back     alignment and structure
>pdb|3SFV|A Chain A, Crystal Structure Of The Gdp-Bound Rab1a S25n Mutant In Complex With The Coiled-Coil Domain Of Lida From Legionella Pneumophila Length = 181 Back     alignment and structure
>pdb|3TKL|A Chain A, Crystal Structure Of The Gtp-Bound Rab1a In Complex With The Coiled- Coil Domain Of Lida From Legionella Pneumophila Length = 196 Back     alignment and structure
>pdb|3JZA|A Chain A, Crystal Structure Of Human Rab1b In Complex With The Gef Domain Of DrraSIDM FROM LEGIONELLA PNEUMOPHILA Length = 175 Back     alignment and structure
>pdb|4I1O|A Chain A, Crystal Structure Of The Legionella Pneumophila Gap Domain Of Lepb In Complex With Rab1b Bound To Gdp And Bef3 Length = 181 Back     alignment and structure
>pdb|1YZQ|A Chain A, Gppnhp-Bound Rab6 Gtpase Length = 170 Back     alignment and structure
>pdb|4FMD|F Chain F, Espg-Rab1 Complex Structure At 3.05 A Length = 164 Back     alignment and structure
>pdb|2GIL|A Chain A, Structure Of The Extremely Slow Gtpase Rab6a In The Gtp Bound Form At 1.8 Resolution Length = 162 Back     alignment and structure
>pdb|2Y8E|A Chain A, Crystal Structure Of D. Melanogaster Rab6 Gtpase Bound To Gmppnp Length = 179 Back     alignment and structure
>pdb|3BFK|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab11a In Complex With Gdp Length = 181 Back     alignment and structure
>pdb|4FMC|F Chain F, Espg-Rab1 Complex Length = 117 Back     alignment and structure
>pdb|3RWM|B Chain B, Crystal Structure Of Ypt32 In Complex With Gppnhp Length = 185 Back     alignment and structure
>pdb|2HUP|A Chain A, Crystal Structure Of Human Rab43 In Complex With Gdp Length = 201 Back     alignment and structure
>pdb|2WWX|A Chain A, Crystal Structure Of The SidmDRRA(GEFGDF DOMAIN)-Rab1 (Gtpase Domain) Complex Length = 175 Back     alignment and structure
>pdb|2F7S|A Chain A, The Crystal Structure Of Human Rab27b Bound To Gdp Length = 217 Back     alignment and structure
>pdb|3CPH|A Chain A, Crystal Structure Of Sec4 In Complex With Rab-Gdi Length = 213 Back     alignment and structure
>pdb|2P5S|A Chain A, Rab Domain Of Human Rasef In Complex With Gdp Length = 199 Back     alignment and structure
>pdb|2FE4|A Chain A, The Crystal Structure Of Human Neuronal Rab6b In Its Inactive Gdp-Bound Form Length = 171 Back     alignment and structure
>pdb|1ZBD|A Chain A, Structural Basis Of Rab Effector Specificity: Crystal Structure Of The Small G Protein Rab3a Complexed With The Effector Domain Of Rabphilin-3a Length = 203 Back     alignment and structure
>pdb|2GF9|A Chain A, Crystal Structure Of Human Rab3d In Complex With Gdp Length = 189 Back     alignment and structure
>pdb|4EPR|A Chain A, Discovery Of Small Molecules That Bind To K-Ras And Inhibit Sos- Mediated Activation Length = 170 Back     alignment and structure
>pdb|2EQB|A Chain A, Crystal Structure Of The Rab Gtpase Sec4p, The Sec2p Gef Domain, And Phosphate Complex Length = 174 Back     alignment and structure
>pdb|2FU5|C Chain C, Structure Of Rab8 In Complex With Mss4 Length = 183 Back     alignment and structure
>pdb|3QBT|A Chain A, Crystal Structure Of Ocrl1 540-678 In Complex With Rab8a:gppnhp Length = 174 Back     alignment and structure
>pdb|1G17|A Chain A, Crystal Structure Of Sec4-Guanosine-5'-(Beta,Gamma)- Imidotriphosphate Length = 170 Back     alignment and structure
>pdb|1KY2|A Chain A, Gppnhp-Bound Ypt7p At 1.6 A Resolution Length = 182 Back     alignment and structure
>pdb|1GUA|A Chain A, Human Rap1a, Residues 1-167, Double Mutant (E30d,K31e) Complexed With Gppnhp And The Ras-Binding-Domain Of Human C-Raf1, Residues 51-131 Length = 167 Back     alignment and structure
>pdb|4DSO|A Chain A, Small-Molecule Ligands Bind To A Distinct Pocket In Ras And Inhibit Sos-Mediated Nucleotide Exchange Activity Length = 189 Back     alignment and structure
>pdb|2IL1|A Chain A, Crystal Structure Of A Predicted Human Gtpase In Complex With Gdp Length = 192 Back     alignment and structure
>pdb|4DKX|A Chain A, Crystal Structure Of The Rab 6a'(Q72l) Length = 216 Back     alignment and structure
>pdb|1D5C|A Chain A, Crystal Structure Of Plasmodium Falciparum Rab6 Complexed With Gdp Length = 162 Back     alignment and structure
>pdb|2OCY|C Chain C, Complex Of The Guanine Exchange Factor Sec2p And The Rab Gtpase Sec4p Length = 170 Back     alignment and structure
>pdb|1Z08|A Chain A, Gppnhp-Bound Rab21 Q53g Mutant Gtpase Length = 170 Back     alignment and structure
>pdb|3CWZ|A Chain A, Strucure Of Rab6(Gtp)-R6ip1 Complex Length = 188 Back     alignment and structure
>pdb|2BMD|A Chain A, High Resolution Structure Of Gdp-Bound Human Rab4a Length = 186 Back     alignment and structure
>pdb|1N6O|A Chain A, Crystal Structure Of Human Rab5a A30k Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|1C1Y|A Chain A, Crystal Structure Of Rap.Gmppnp In Complex With The Ras- Binding-Domain Of C-Raf1 Kinase (Rafrbd) Length = 167 Back     alignment and structure
>pdb|3CPJ|B Chain B, Crystal Structure Of Ypt31 In Complex With Yeast Rab-Gdi Length = 223 Back     alignment and structure
>pdb|2IF0|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 200 Back     alignment and structure
>pdb|1Z0A|A Chain A, Gdp-Bound Rab2a Gtpase Length = 174 Back     alignment and structure
>pdb|1G16|A Chain A, Crystal Structure Of Sec4-Gdp Length = 170 Back     alignment and structure
>pdb|1VG1|A Chain A, Gdp-bound Rab7 Length = 185 Back     alignment and structure
>pdb|2FH5|B Chain B, The Structure Of The Mammalian Srp Receptor Length = 214 Back     alignment and structure
>pdb|2EFC|B Chain B, Ara7-GdpATVPS9A Length = 181 Back     alignment and structure
>pdb|1VG0|B Chain B, The Crystal Structures Of The Rep-1 Protein In Complex With Monoprenylated Rab7 Protein Length = 207 Back     alignment and structure
>pdb|2A5J|A Chain A, Crystal Structure Of Human Rab2b Length = 191 Back     alignment and structure
>pdb|3BBP|A Chain A, Rab6-Gtp:gcc185 Rab Binding Domain Complex Length = 211 Back     alignment and structure
>pdb|1N6N|A Chain A, Crystal Structure Of Human Rab5a A30r Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|2IEZ|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Monoclinic Space Group Length = 220 Back     alignment and structure
>pdb|1YU9|A Chain A, Gppnhp-Bound Rab4a Length = 175 Back     alignment and structure
>pdb|1OIV|A Chain A, X-Ray Structure Of The Small G Protein Rab11a In Complex With Gdp Length = 191 Back     alignment and structure
>pdb|3BRW|D Chain D, Structure Of The Rap-Rapgap Complex Length = 167 Back     alignment and structure
>pdb|1YZK|A Chain A, Gppnhp Bound Rab11 Gtpase Length = 184 Back     alignment and structure
>pdb|2F9L|A Chain A, 3d Structure Of Inactive Human Rab11b Gtpase Length = 199 Back     alignment and structure
>pdb|1N6P|A Chain A, Crystal Structure Of Human Rab5a A30e Mutant Complex With Gppnhp Length = 170 Back     alignment and structure
>pdb|3LAW|A Chain A, Structure Of Gtp-Bound L129f Mutant Rab7 Length = 207 Back     alignment and structure
>pdb|1TU4|A Chain A, Crystal Structure Of Rab5-Gdp Complex Length = 171 Back     alignment and structure
>pdb|4DXA|A Chain A, Co-Crystal Structure Of Rap1 In Complex With Krit1 Length = 169 Back     alignment and structure
>pdb|1Z22|A Chain A, Gdp-Bound Rab23 Gtpase Crystallized In C222(1) Space Group Length = 168 Back     alignment and structure
>pdb|1TU3|A Chain A, Crystal Structure Of Rab5 Complex With Rabaptin5 C-Terminal Domain Length = 171 Back     alignment and structure
>pdb|2IEY|A Chain A, Crystal Structure Of Mouse Rab27b Bound To Gdp In Hexagonal Space Group Length = 195 Back     alignment and structure
>pdb|1YZU|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.50 A Resolution Length = 170 Back     alignment and structure
>pdb|1N6H|A Chain A, Crystal Structure Of Human Rab5a Length = 170 Back     alignment and structure
>pdb|1YZT|A Chain A, Gppnhp-Bound Rab21 Gtpase At 2.05 A Resolution Length = 184 Back     alignment and structure
>pdb|2HEI|A Chain A, Crystal Structure Of Human Rab5b In Complex With Gdp Length = 179 Back     alignment and structure
>pdb|1N6I|A Chain A, Crystal Structure Of Human Rab5a A30p Mutant Complex With Gdp Length = 170 Back     alignment and structure
>pdb|2ZET|A Chain A, Crystal Structure Of The Small Gtpase Rab27b Complexed With The Slp Homology Domain Of Slac2-AMELANOPHILIN Length = 203 Back     alignment and structure
>pdb|1YVD|A Chain A, Gppnhp-Bound Rab22 Gtpase Length = 169 Back     alignment and structure
>pdb|1Z07|A Chain A, Gppnhp-Bound Rab5c G55q Mutant Gtpase Length = 166 Back     alignment and structure
>pdb|1N6R|A Chain A, Crystal Structure Of Human Rab5a A30l Mutant Complex With Gppnhp Length = 170 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 1e-78
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 4e-78
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 2e-77
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 7e-77
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 8e-76
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 1e-74
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 2e-74
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 4e-74
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 6e-74
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 2e-72
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 1e-71
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 2e-67
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 3e-65
3o47_A329 ADP-ribosylation factor GTPase-activating protein 1e-61
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-56
3t1o_A198 Gliding protein MGLA; G domain containing protein, 2e-49
2fh5_B214 SR-beta, signal recognition particle receptor beta 1e-43
2ged_A193 SR-beta, signal recognition particle receptor beta 8e-39
1nrj_B218 SR-beta, signal recognition particle receptor beta 2e-37
3llu_A196 RAS-related GTP-binding protein C; structural geno 4e-26
3l82_B227 F-box only protein 4; TRFH domain, helix, GTPase d 1e-21
3r7w_A 307 Gtpase1, GTP-binding protein GTR1; RAG gtpases, GT 1e-20
3l2o_B312 F-box only protein 4; small G protein fold, UBL co 7e-18
3r7w_B 331 Gtpase2, GTP-binding protein GTR2; RAG gtpases, GT 4e-15
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 5e-11
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 1e-10
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 8e-10
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 1e-09
2e87_A357 Hypothetical protein PH1320; GTP-binding, GTPase, 2e-09
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 2e-09
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 3e-09
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 4e-09
1azs_C402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 5e-09
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 9e-09
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 1e-08
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 2e-08
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 3e-08
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 4e-08
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 4e-08
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 5e-08
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 5e-08
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 6e-08
3ohm_A327 Guanine nucleotide-binding protein G(Q) subunit A; 6e-08
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 6e-08
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 1e-07
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 1e-07
1cip_A353 Protein (guanine nucleotide-binding protein alpha- 1e-07
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 2e-07
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 2e-07
3gj0_A221 GTP-binding nuclear protein RAN; G protein, GDP, a 2e-07
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 3e-07
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 3e-07
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 3e-07
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 3e-07
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 3e-07
3th5_A204 RAS-related C3 botulinum toxin substrate 1; rossma 3e-07
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 3e-07
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 4e-07
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 4e-07
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 4e-07
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 5e-07
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 5e-07
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 7e-07
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 7e-07
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 8e-07
3l0i_B199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 9e-07
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 1e-06
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 1e-06
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 1e-06
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 1e-06
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 2e-06
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 2e-06
3bbp_A211 RAB-6, RAS-related protein RAB-6A; golgi complex, 2e-06
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 2e-06
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 2e-06
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 2e-06
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 2e-06
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 3e-06
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 3e-06
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 3e-06
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 3e-06
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 3e-06
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 4e-06
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 4e-06
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 5e-06
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 5e-06
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 6e-06
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 6e-06
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 6e-06
2xtz_A354 Guanine nucleotide-binding protein alpha-1 subuni; 7e-06
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 7e-06
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 7e-06
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 7e-06
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 8e-06
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 1e-05
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 1e-05
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 1e-05
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 2e-05
4djt_A218 GTP-binding nuclear protein GSP1; structural genom 2e-05
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 2e-05
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 3e-05
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 3e-05
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 4e-05
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 4e-05
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 4e-05
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 4e-05
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 6e-05
1xzp_A482 Probable tRNA modification GTPase TRME; GTP-bindin 7e-05
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 8e-05
2yc2_C208 IFT27, small RAB-related GTPase; transport protein 8e-05
3geh_A462 MNME, tRNA modification GTPase MNME; G protein, U3 1e-04
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 1e-04
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 1e-04
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 2e-04
3gee_A476 MNME, tRNA modification GTPase MNME; G protein, cy 3e-04
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 3e-04
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 4e-04
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 6e-04
3c5h_A255 Glucocorticoid receptor DNA-binding factor 1; RAS, 9e-04
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Length = 181 Back     alignment and structure
 Score =  232 bits (593), Expect = 1e-78
 Identities = 65/189 (34%), Positives = 100/189 (52%), Gaps = 9/189 (4%)

Query: 1   MFSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNI 60
           + S+   L        E  +L+LG+D AGKTTLL++L              I PT G NI
Sbjct: 2   LLSILRKLKS--APDQEVRILLLGLDNAGKTTLLKQLA-------SEDISHITPTQGFNI 52

Query: 61  GRIEVSNSKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRN 120
             ++    KL  WD+GGQ  +R  W  Y+E    +++VID+A   RFE++   L ++L  
Sbjct: 53  KSVQSQGFKLNVWDIGGQRKIRPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEE 112

Query: 121 EDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWL 180
           E L   P+LI ANKQDL  A  A E+A  L+L  + +RV   ++ S   G G+++ + W+
Sbjct: 113 EKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWV 172

Query: 181 VEVMERSKR 189
            + +   K+
Sbjct: 173 CKNVNAKKK 181


>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 187 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Length = 186 Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 183 Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Length = 188 Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Length = 190 Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Length = 189 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Length = 192 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Length = 181 Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Length = 171 Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Length = 164 Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Length = 190 Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Length = 198 Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Length = 198 Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Length = 214 Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Length = 193 Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 218 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Length = 196 Back     alignment and structure
>3l82_B F-box only protein 4; TRFH domain, helix, GTPase domain, acetylation, ADP- ribosylation, alternative splicing, cell cycle, cell division; 2.40A {Homo sapiens} Length = 227 Back     alignment and structure
>3r7w_A Gtpase1, GTP-binding protein GTR1; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 307 Back     alignment and structure
>3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>3r7w_B Gtpase2, GTP-binding protein GTR2; RAG gtpases, GTR1P, GTR2P, MTOR, protein transport; HET: GNP; 2.77A {Saccharomyces cerevisiae} Length = 331 Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Length = 535 Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Length = 190 Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Length = 184 Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Length = 357 Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Length = 166 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Length = 189 Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Length = 402 Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Length = 183 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* Length = 181 Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Length = 362 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Length = 168 Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Length = 199 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Length = 211 Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Length = 206 Back     alignment and structure
>3ohm_A Guanine nucleotide-binding protein G(Q) subunit A; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Mus musculus} PDB: 2bcj_Q* 2rgn_A* 3ah8_A* Length = 327 Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Length = 195 Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Length = 228 Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Length = 217 Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Length = 353 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Length = 195 Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 Back     alignment and structure
>3gj0_A GTP-binding nuclear protein RAN; G protein, GDP, acetylation, cytoplasm, HOST- virus interaction, nucleotide-binding, nucleus, phosphoprotein; HET: GDP; 1.48A {Homo sapiens} PDB: 3gj3_A* 3gj5_A* 3gj4_A* 3gj6_A* 3gj7_A* 3gj8_A* 1i2m_A 1a2k_C 1ibr_A* 1k5d_A* 1k5g_A* 1qbk_C* 3a6p_C* 3ch5_A* 1qg4_A* 3ea5_A* 1qg2_A* 1byu_A* 3ran_A* 3gjx_C* ... Length = 221 Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Length = 175 Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} Length = 169 Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Length = 166 Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 213 Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Length = 204 Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Length = 170 Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Length = 170 Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} Length = 191 Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 180 Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Length = 203 Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Length = 201 Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Length = 195 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Length = 189 Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Length = 199 Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Length = 183 Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Length = 196 Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 196 Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Length = 182 Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Length = 200 Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Length = 206 Back     alignment and structure
>3bbp_A RAB-6, RAS-related protein RAB-6A; golgi complex, GRIP domain, RAB GTPase, ARL GTPase, golgin, RAB effector, clAsp protein; HET: GTP; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Length = 192 Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Length = 208 Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Length = 189 Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Length = 199 Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Length = 413 Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Length = 214 Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Length = 192 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Length = 193 Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Length = 223 Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Length = 201 Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Length = 179 Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Length = 186 Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Length = 178 Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Length = 181 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Length = 201 Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 207 Back     alignment and structure
>2xtz_A Guanine nucleotide-binding protein alpha-1 subuni; hydrolase, G-protein signaling, SELF-activation, RAS-like DO; HET: GSP; 2.34A {Arabidopsis thaliana} Length = 354 Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Length = 168 Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Length = 207 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Length = 179 Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Length = 191 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Length = 184 Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Length = 177 Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Length = 191 Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Length = 201 Back     alignment and structure
>4djt_A GTP-binding nuclear protein GSP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, RAN family; HET: GDP; 1.80A {Encephalitozoon cuniculi} Length = 218 Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Length = 205 Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Length = 214 Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Length = 192 Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Length = 170 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Length = 170 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Length = 194 Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Length = 170 Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Length = 186 Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Length = 482 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* Length = 194 Back     alignment and structure
>2yc2_C IFT27, small RAB-related GTPase; transport protein, cilium, IFT complex; 2.59A {Chlamydomonas reinhardtii} PDB: 2yc4_C Length = 208 Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Length = 462 Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Length = 182 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Length = 212 Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Length = 187 Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Length = 476 Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Length = 172 Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Length = 181 Back     alignment and structure
>3c5h_A Glucocorticoid receptor DNA-binding factor 1; RAS, GTPase, glucorticoid receptor, structural genomics consortium, SGC, alternative splicing; HET: GNP; 1.80A {Homo sapiens} Length = 255 Back     alignment and structure

Structure Templates Detected by HHsearch ?

No hit with probability above 80.00


Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d1e0sa_173 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 3e-29
d1moza_182 c.37.1.8 (A:) ADP-ribosylation factor {Baker's yea 2e-28
d1zj6a1177 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human 3e-27
d1ksha_165 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 6e-24
d1fzqa_176 c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus 7e-24
d1r8sa_160 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 4e-21
d1azta2221 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha sub 6e-21
d1zd9a1164 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human 3e-20
d1f6ba_186 c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus gr 4e-19
d2fu5c1173 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [Ta 2e-18
d1g16a_166 c.37.1.8 (A:) Rab-related protein Sec4 {Baker's ye 2e-18
d2qtvb1166 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharom 2e-18
d2bcgy1194 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Sac 6e-18
d1x3sa1177 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [Ta 4e-17
d2g6ba1170 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [T 3e-16
d1zcba2200 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha sub 9e-16
d2bcjq2200 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha sub 2e-15
d3raba_169 c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxI 2e-15
d2f7sa1186 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [T 3e-15
d2fh5b1207 c.37.1.8 (B:63-269) Signal recognition particle re 4e-15
d1upta_169 c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo 1e-14
d2bmea1174 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [Ta 2e-14
d2f9la1175 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [T 6e-14
d2ew1a1171 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [Ta 6e-14
d1svsa1195 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub 9e-13
d2a5ja1173 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [Ta 2e-12
d1kaoa_167 c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 3e-12
d1ctqa_166 c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapi 5e-12
d1u8za_168 c.37.1.8 (A:) Ras-related protein RalA {Cotton-top 6e-12
d1z0fa1166 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [Ta 3e-11
d1yzqa1164 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [Ta 5e-11
d1c1ya_167 c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 8e-11
d1ek0a_170 c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces 1e-10
d1tq4a_ 400 c.37.1.8 (A:) Interferon-inducible GTPase {Mouse ( 4e-10
d1r2qa_170 c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 5e-10
d1ky3a_175 c.37.1.8 (A:) Rab-related protein ypt7p {Baker's y 6e-10
d1vg8a_184 c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId 1e-09
d1z06a1165 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) 3e-09
d1wmsa_174 c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 3e-09
d1nrjb_209 c.37.1.8 (B:) Signal recognition particle receptor 1e-08
d1z08a1167 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [T 1e-08
d1x1ra1169 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRa 2e-08
d2fn4a1173 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [T 3e-08
d2erxa1171 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [ 5e-08
d1udxa2180 c.37.1.8 (A:157-336) Obg GTP-binding protein middl 5e-08
d1i2ma_170 c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 96 6e-07
d2ngra_191 c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 7e-07
d2erya1171 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [ 1e-06
d2g3ya1172 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human 2e-06
d1z2aa1164 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [Ta 7e-06
d1z0ja1167 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [ 1e-05
d1puja_ 273 c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subti 2e-05
d1mh1a_183 c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 4e-05
d2atxa1185 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax 4e-05
d1kmqa_177 c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 5e-05
d1xtqa1167 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human 2e-04
d2gjsa1168 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [Tax 2e-04
d1xzpa2160 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotog 3e-04
d2bmja1175 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H 6e-04
d1lnza2185 c.37.1.8 (A:158-342) Obg GTP-binding protein middl 6e-04
d1m7ba_179 c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [T 0.001
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Length = 173 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Human (Homo sapiens), ARF6 [TaxId: 9606]
 Score =  105 bits (261), Expect = 3e-29
 Identities = 60/175 (34%), Positives = 94/175 (53%), Gaps = 7/175 (4%)

Query: 8   LWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSN 67
           +   IF   E  +L+LG+D AGKTT+L KLK   S          +PTVG N+  +   N
Sbjct: 3   VLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQS-------VTTIPTVGFNVETVTYKN 55

Query: 68  SKLVFWDLGGQPGLRSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAP 127
            K   WD+GGQ  +R +W  YY     ++FV+D A   R ++++  L +++ + +++ A 
Sbjct: 56  VKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAI 115

Query: 128 LLILANKQDLPDAVSADELARYLDLKKLDERVCMFEAVSGYDGFGIKESVEWLVE 182
           +LI ANKQDLPDA+   E+   L L ++ +R    +      G G+ E + WL  
Sbjct: 116 ILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTS 170


>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Length = 182 Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Length = 176 Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Length = 160 Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Length = 221 Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Length = 186 Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Length = 173 Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 166 Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 194 Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Length = 200 Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 169 Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Length = 186 Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 207 Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Length = 168 Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 170 Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Length = 400 Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 175 Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 184 Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Length = 165 Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Length = 169 Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Length = 180 Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Length = 171 Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Length = 164 Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Length = 167 Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Length = 273 Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Length = 167 Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Length = 168 Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Length = 160 Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Length = 185 Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 100.0
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 100.0
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 100.0
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 100.0
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.98
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 99.97
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 99.97
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 99.97
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 99.97
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 99.97
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 99.97
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 99.97
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 99.96
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 99.96
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 99.96
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 99.96
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.96
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 99.96
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 99.96
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 99.96
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.96
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 99.96
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 99.96
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 99.95
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 99.95
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 99.94
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.92
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 99.92
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 99.92
d1wb1a4179 Elongation factor SelB, N-terminal domain {Methano 99.92
d2qn6a3205 Initiation factor eIF2 gamma subunit, N-terminal ( 99.92
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.91
d1kk1a3195 Initiation factor eIF2 gamma subunit, N-terminal ( 99.9
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 99.9
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 99.9
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 99.9
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 99.9
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 99.9
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 99.89
d1d2ea3196 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.89
d1g7sa4227 Initiation factor IF2/eIF5b, N-terminal (G) domain 99.88
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 99.88
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 99.88
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 99.88
d2c78a3204 Elongation factor Tu (EF-Tu), N-terminal (G) domai 99.88
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 99.87
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 99.86
d1zunb3222 Sulfate adenylate transferase subunit cysN/C, EF-T 99.86
d2fh5b1207 Signal recognition particle receptor beta-subunit 99.84
d2bv3a2276 Elongation factor G (EF-G), N-terminal (G) domain 99.82
d2dy1a2267 Elongation factor G (EF-G), N-terminal (G) domain 99.82
d1f60a3239 Elongation factor eEF-1alpha, N-terminal (G) domai 99.82
d1jnya3224 Elongation factor eEF-1alpha, N-terminal (G) domai 99.8
d1r5ba3245 Eukaryotic peptide chain release factor ERF2, G do 99.8
d1nrjb_209 Signal recognition particle receptor beta-subunit 99.77
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 99.76
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 99.74
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 99.7
d1n0ua2341 Elongation factor 2 (eEF-2), N-terminal (G) domain 99.67
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 99.62
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 99.56
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 99.56
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 99.55
d1jala1278 YchF GTP-binding protein N-terminal domain {Haemop 99.27
d1wxqa1 319 GTP-binding protein PH0525 {Pyrococcus horikoshii 99.2
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 99.2
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 99.14
d1ni3a1296 YchF GTP-binding protein N-terminal domain {Fissio 99.14
d1puja_273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.72
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 98.68
d1u0la2 225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.49
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 98.38
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 98.33
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.22
d1j8yf2211 GTPase domain of the signal sequence recognition p 98.17
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 98.08
d1vmaa2213 GTPase domain of the signal recognition particle r 98.07
d1ls1a2207 GTPase domain of the signal sequence recognition p 98.0
d1okkd2207 GTPase domain of the signal recognition particle r 97.98
d2qy9a2211 GTPase domain of the signal recognition particle r 97.96
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 97.68
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 97.64
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 97.57
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 97.48
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 97.47
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 97.43
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 97.4
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 97.4
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 97.38
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 97.34
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 97.33
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 97.32
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.27
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.27
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.27
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 97.27
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 97.26
d2awna2232 Maltose transport protein MalK, N-terminal domain 97.25
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 97.24
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 97.22
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 97.22
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 97.21
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 97.21
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 97.19
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 97.16
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 97.15
d1g2912240 Maltose transport protein MalK, N-terminal domain 97.15
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 97.14
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 97.09
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 97.08
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 97.08
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 97.08
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 97.08
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 97.06
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 97.06
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 97.06
d2hyda1255 Putative multidrug export ATP-binding/permease pro 97.04
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 97.01
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.0
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 96.98
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 96.97
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 96.93
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 96.93
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 96.92
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 96.92
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 96.9
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 96.9
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 96.9
d1sq5a_308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.9
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 96.86
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 96.86
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 96.85
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 96.84
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 96.79
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 96.77
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 96.76
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 96.76
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 96.76
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 96.74
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 96.7
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 96.7
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 96.68
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 96.64
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.64
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 96.63
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 96.62
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 96.59
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.57
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.56
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 96.54
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 96.54
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 96.54
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 96.5
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 96.49
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 96.49
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 96.45
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.4
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 96.35
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 96.33
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 96.3
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 96.25
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 96.25
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 96.21
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 96.18
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 96.17
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 96.17
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.15
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 96.08
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 96.06
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 96.02
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 95.98
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 95.95
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.94
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.9
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.85
d1svma_362 Papillomavirus large T antigen helicase domain {Si 95.81
g1xew.1 329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 95.77
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 95.72
d1g3qa_237 Cell division regulator MinD {Archaeon Pyrococcus 95.72
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 95.65
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.5
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 95.5
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 95.47
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 95.47
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 95.47
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 95.46
d1osna_ 331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 95.44
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 95.37
d1g8pa_ 333 ATPase subunit of magnesium chelatase, BchI {Rhodo 95.36
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 95.33
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.28
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 95.25
g1ii8.1 369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 95.25
d1p6xa_ 333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 95.2
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 95.2
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 95.18
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 94.7
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.69
d1e2ka_ 329 Thymidine kinase {Herpes simplex virus type 1, dif 94.61
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 94.59
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.35
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 94.34
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 94.29
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 94.14
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.12
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 94.06
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 94.05
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 93.92
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 93.86
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 93.81
d1hyqa_232 Cell division regulator MinD {Archaeon Archaeoglob 93.33
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 93.28
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 93.28
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 93.2
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 93.17
d1tuea_205 Replication protein E1 helicase domain {Human papi 93.08
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 93.0
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 92.96
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 92.75
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 92.67
d1g8fa3122 ATP sulfurylase C-terminal domain {Baker's yeast ( 92.66
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 92.49
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 92.45
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.35
d1xpua3289 Transcription termination factor Rho, ATPase domai 92.19
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 92.04
d1qvra3315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 91.83
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.82
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 91.25
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 90.69
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 89.52
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 88.95
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 88.87
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 88.69
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 87.86
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 87.22
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 86.36
d2olra1 313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 86.25
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 85.85
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 85.73
d1j3ba1 318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 85.62
d1ii2a1 323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo 84.99
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 84.84
d1c9ka_180 Adenosylcobinamide kinase/adenosylcobinamide phosp 83.95
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 83.09
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 83.0
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 80.93
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 80.35
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: G proteins
domain: ADP-ribosylation factor
species: Mouse (Mus musculus), ARL3 [TaxId: 10090]
Probab=100.00  E-value=2.7e-32  Score=178.52  Aligned_cols=173  Identities=38%  Similarity=0.665  Sum_probs=144.9

Q ss_pred             HHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEEEEEEECCEEEEEECCCCCCH
Q ss_conf             54899998644077611899982899976799999973014778999996545632014699871827999975899111
Q 028750            2 FSLFYGLWKYIFTKTEFHVLILGIDKAGKTTLLEKLKSVYSNVEGLPPDRIVPTVGLNIGRIEVSNSKLVFWDLGGQPGL   81 (204)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~i~iiG~~~~GKStli~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~D~~g~~~~   81 (204)
                      ++.+..+  ...+++.+||+++|++|||||||++++.+      +.. ....++.+.....+...+..+.+||++|+..+
T Consensus         3 ~~~~~k~--~~~~~~~~kI~vvG~~~vGKSsLi~~l~~------~~~-~~~~~~~~~~~~~i~~~~~~~~i~d~~g~~~~   73 (176)
T d1fzqa_           3 LSILRKL--KSAPDQEVRILLLGLDNAGKTTLLKQLAS------EDI-SHITPTQGFNIKSVQSQGFKLNVWDIGGQRKI   73 (176)
T ss_dssp             CCHHHHC--SSCCSSCEEEEEEESTTSSHHHHHHHHCC------SCC-EEEEEETTEEEEEEEETTEEEEEEECSSCGGG
T ss_pred             HHHHHHH--HCCCCCEEEEEEECCCCCCHHHHHHHHHC------CCC-CCCEEEEEEEEEEECCCCEEEEEEECCCCCCC
T ss_conf             7899871--17899877999999999899999999964------877-75202331058985048856767632542100


Q ss_pred             HHHHHHHCCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCEEEEEEECCCCCCCCCHHHHHHHHCCCCCCCCEEE
Q ss_conf             99999840248989999959998898999999999983599999919999728997786699899978284554642038
Q 028750           82 RSIWEKYYEEAHAVVFVIDAACPSRFEDSKTALEKVLRNEDLQGAPLLILANKQDLPDAVSADELARYLDLKKLDERVCM  161 (204)
Q Consensus        82 ~~~~~~~~~~~d~ii~v~d~~~~~s~~~~~~~~~~~~~~~~~~~~p~ivv~nK~D~~~~~~~~~~~~~~~~~~~~~~~~~  161 (204)
                      ...+...+..+|++++|+|+++..++.....++..+.......++|+++++||+|+.......++.+.+..........+
T Consensus        74 ~~~~~~~~~~~~~ii~v~d~~d~~s~~~~~~~~~~~~~~~~~~~~pillv~nK~Dl~~~~~~~~~~~~~~~~~~~~~~~~  153 (176)
T d1fzqa_          74 RPYWRSYFENTDILIYVIDSADRKRFEETGQELTELLEEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQ  153 (176)
T ss_dssp             HHHHHHHHTTCSEEEEEEETTCGGGHHHHHHHHHHHTTCGGGTTCCEEEEEECTTSTTCCCHHHHHHHTTGGGCCSSCEE
T ss_pred             HHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCE
T ss_conf             14778876415526886204565424444455443344303699859999974054542428999999878777736988


Q ss_pred             EEEECCCCCCCHHHHHHHHHHH
Q ss_conf             8741136898968999999999
Q 028750          162 FEAVSGYDGFGIKESVEWLVEV  183 (204)
Q Consensus       162 ~~~~Sa~~~~~i~~l~~~i~~~  183 (204)
                      ++++||++|+|++++|+||.+.
T Consensus       154 ~~~~SA~tg~gv~e~~~~l~~~  175 (176)
T d1fzqa_         154 IQSCSALTGEGVQDGMNWVCKN  175 (176)
T ss_dssp             EEECCTTTCTTHHHHHHHHHHT
T ss_pred             EEEEECCCCCCHHHHHHHHHHC
T ss_conf             9998699898999999999961



>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} Back     information, alignment and structure
>d1f60a3 c.37.1.8 (A:2-240) Elongation factor eEF-1alpha, N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0ua2 c.37.1.8 (A:3-343) Elongation factor 2 (eEF-2), N-terminal (G) domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure