Citrus Sinensis ID: 028757


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQTLSLRRYR
ccHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEcccccccHHHHHHcccccccEEEEEEEEECcccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEEEEEcccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccEEECcc
*GAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKR******VYGK*********KFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTS*************************WKRNQTLS*RRYR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGAYKYVSELWRKKQSDVMRFLQRVRCWEYRQHPSIVRVTRPTRPDKARRLGYKAKQGYVVYRVRVRRGGRKRPVPKGIVYGKPTNQGVTQLKFQRSKRSVAEERAGRKLGGLKVLNSYWINEDSTYKYFEVILVDAAHNAIRNDPRINWICKPVHKHRELRGLTSAGKKYRGLRGKGHLHHKARPSRRATWKRNQTLSLRRYR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L15-1 confidentO23515
60S ribosomal protein L15-B confidentP54780
60S ribosomal protein L15-B confidentQ9US22

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IZR, chain P
Confidence level:very confident
Coverage over the Query: 1-194
View the alignment between query and template
View the model in PyMOL