Query         028758
Match_columns 204
No_of_seqs    147 out of 202
Neff          4.4 
Searched_HMMs 46136
Date          Fri Mar 29 16:31:28 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028758.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028758hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN00059 PsbP domain-containin 100.0 6.8E-31 1.5E-35  232.2  10.6  118   59-179    74-204 (286)
  2 PLN00042 photosystem II oxygen 100.0 3.6E-30 7.7E-35  226.8   9.9  119   59-179    47-193 (260)
  3 PF01789 PsbP:  PsbP;  InterPro  99.9 4.2E-24   9E-29  176.1   8.0   97   83-179    11-111 (175)
  4 PLN00066 PsbP domain-containin  99.9 2.1E-21 4.6E-26  171.8  11.6  120   59-178    42-202 (262)
  5 PLN00067 PsbP domain-containin  99.8 9.9E-21 2.1E-25  167.2  10.9  121   56-179    37-201 (263)
  6 PLN03152 hypothetical protein;  98.9 3.2E-09 6.9E-14   93.0   5.8   99   60-161    29-166 (241)
  7 PF12712 DUF3805:  Domain of un  89.4    0.52 1.1E-05   39.3   4.0   45   96-141     2-47  (153)
  8 PF10518 TAT_signal:  TAT (twin  56.3      14 0.00031   22.0   2.6   12   62-73      2-13  (26)
  9 TIGR02811 formate_TAT formate   54.0      18 0.00039   26.1   3.3   11   59-69      6-16  (66)
 10 PF07174 FAP:  Fibronectin-atta  53.4      31 0.00067   31.9   5.3   66   96-163   110-191 (297)
 11 PF08006 DUF1700:  Protein of u  52.0     8.4 0.00018   31.8   1.5   20  145-164    45-64  (181)
 12 PLN00058 photosystem II reacti  33.7      32  0.0007   27.2   2.0   21   59-79     46-66  (103)
 13 PF12559 Inhibitor_I10:  Serine  32.9      16 0.00035   26.0   0.2   12  104-115    44-55  (56)
 14 PRK11615 hypothetical protein;  30.0 2.4E+02  0.0052   24.6   6.9   72   85-164    31-107 (185)
 15 PF10399 UCR_Fe-S_N:  Ubiquitin  29.7      45 0.00098   22.1   2.0   15   57-71      4-18  (41)
 16 PRK10882 hydrogenase 2 protein  29.3      79  0.0017   29.3   4.1   13   62-74      1-13  (328)
 17 cd04458 CSP_CDS Cold-Shock Pro  28.7      81  0.0017   21.4   3.2   27   94-126     3-29  (65)
 18 PRK10943 cold shock-like prote  28.6      67  0.0014   22.9   2.9   20   93-112     5-24  (69)
 19 TIGR03741 PRTRC_E PRTRC system  26.6 1.1E+02  0.0023   24.2   3.9   34  133-166    24-66  (104)
 20 COG4784 Putative Zn-dependent   24.8      53  0.0012   31.7   2.2   37   83-119   272-311 (479)
 21 PLN00054 photosystem I reactio  24.6      80  0.0017   26.2   2.9   15   59-73     25-39  (139)
 22 TIGR02381 cspD cold shock doma  22.3 1.2E+02  0.0025   21.5   3.1   20   93-112     3-22  (68)
 23 PRK09937 stationary phase/star  21.7 1.2E+02  0.0026   22.1   3.2   20   93-112     3-22  (74)
 24 PLN02729 PSII-Q subunit         21.6      49  0.0011   29.5   1.2   27   61-90     49-76  (220)
 25 PF05757 PsbQ:  Oxygen evolving  20.9      34 0.00074   29.9   0.1   16   58-73     25-40  (202)

No 1  
>PLN00059 PsbP domain-containing protein 1; Provisional
Probab=99.97  E-value=6.8e-31  Score=232.21  Aligned_cols=118  Identities=29%  Similarity=0.419  Sum_probs=101.4

Q ss_pred             cCccchHHHHHHHH--HHhhhhhcCCCCcccccccccCceeeeeCCCCeEEeecCCceeeeecCcceeecCCCCCCcceE
Q 028758           59 LDKCGRRQMIAVGV--IAPWVSLVNQTPPSFAAESNKGFLSVTDKKDGYSFVYPFGWQEVIIEGQDKVFKDVIEPLESVS  136 (204)
Q Consensus        59 ~~~~~RR~aL~~~a--~Aa~~s~~~~a~~A~Ae~~~~Gf~~Y~D~~dGYsFlyP~gW~ev~~~G~dv~F~D~~~~~eNVS  136 (204)
                      ...++||++|+.++  +..+.+.++ .+.|+|+  +.||++|+|+.|||+|+||.||++|.+.|+|++|||+++++||||
T Consensus        74 ~~~~~rr~~~~~~l~~~~~~~s~~~-~~~a~a~--~~~l~~y~D~~DGY~FlYP~GWi~V~~~G~DVvFrD~Ie~~ENVS  150 (286)
T PLN00059         74 VCAVGRRKSMMMGLLMSGLIVSEAN-LPTAFAS--IPVFREYIDTFDGYSFKYPQNWIQVRGAGADIFFRDPVVLDENLS  150 (286)
T ss_pred             hhhhhhhhhhHHHHHHHHHHHHhhc-CchhhcC--CcccceeEcCCCCeEEeCCCCCeEeccCCCceEEeccCccccceE
Confidence            35778999976544  334455443 4478887  448999999999999999999999999999999999999999999


Q ss_pred             EEEecCC---CCCcccCCCHHHHHHHHHhhhhcCC-----C---ceeeecchhh
Q 028758          137 VNLIPTG---KQDIRDFGPPQEVCSIFSSAIFFIH-----N---KTEIYDPFYA  179 (204)
Q Consensus       137 VvVsp~~---~~sI~dlGsPeeVae~L~kq~~a~p-----~---~a~Lida~~~  179 (204)
                      |+|+|++   +++|+|||+|+||||+|++++++++     |   +++||++..+
T Consensus       151 V~ISs~sss~~~sLeDLGsP~eVgerLlkqvLa~f~str~GsgReaeLVsA~~R  204 (286)
T PLN00059        151 VEFSSPSSSKYTSLEDLGSPEEVGKRVLRQYLTEFMSTRLGVKREANILSTSSR  204 (286)
T ss_pred             EEEecCCcccCCChHHcCCHHHHHHHHHHHHhcccccccCCCCcceEEEEeeeE
Confidence            9999875   8999999999999999999999974     3   9999999855


No 2  
>PLN00042 photosystem II oxygen-evolving enhancer protein 2; Provisional
Probab=99.96  E-value=3.6e-30  Score=226.82  Aligned_cols=119  Identities=24%  Similarity=0.413  Sum_probs=105.5

Q ss_pred             cCccchHHHHHHHHHH-hhhhhcCCCCcccccc--------cccCceeeeeCCCCeEEeecCCcee---eeecCcceeec
Q 028758           59 LDKCGRRQMIAVGVIA-PWVSLVNQTPPSFAAE--------SNKGFLSVTDKKDGYSFVYPFGWQE---VIIEGQDKVFK  126 (204)
Q Consensus        59 ~~~~~RR~aL~~~a~A-a~~s~~~~a~~A~Ae~--------~~~Gf~~Y~D~~dGYsFlyP~gW~e---v~~~G~dv~F~  126 (204)
                      ...++||.+|+++++| +.++.++|+++||+|+        ..+||.+|  ++|||+|+||++|++   ++++|+|++|+
T Consensus        47 ~~~~srr~~l~~~~ga~a~~~~~~pa~aay~~~anvfg~~k~~~gF~~y--~~dgY~FlyP~~W~~~ke~~~~G~dv~f~  124 (260)
T PLN00042         47 NSAVSRRAALALLAGAAAAGAKVSPANAAYGESANVFGKPKTNTGFLPY--NGDGFKLLVPSKWNPSKEREFPGQVLRFE  124 (260)
T ss_pred             cccccHHHHHHHHHHHHHhhcccCchhhhhcchhhccCCCCCCCCCeEe--eCCCeEEecCCCCccccccccCCceEEee
Confidence            4568899999888875 6789999999999986        36999999  469999999999994   45679999999


Q ss_pred             CCCCCCcceEEEEecCCCCCcccCCCHHH----HHHHHHhhhhcCC---------C---ceeeecchhh
Q 028758          127 DVIEPLESVSVNLIPTGKQDIRDFGPPQE----VCSIFSSAIFFIH---------N---KTEIYDPFYA  179 (204)
Q Consensus       127 D~~~~~eNVSVvVsp~~~~sI~dlGsPee----Vae~L~kq~~a~p---------~---~a~Lida~~~  179 (204)
                      |+++++|||||+|+|+++++|+|||+|||    |+++|++|+++++         +   +++||++..+
T Consensus       125 D~~~~~eNVSV~Ispt~k~sI~dlGsPee~l~~vgylL~kq~~a~~t~s~~Gf~p~~vata~Lleas~r  193 (260)
T PLN00042        125 DNFDATSNLSVMVTPTDKKSITDYGSPEEFLSKVSYLLGKQAYSGETASEGGFDANAVATAAVLESSTQ  193 (260)
T ss_pred             ccccccccEEEEEecCCcCCHhhcCCHHHHHHHHHHHHHhhhccCccccccCcCcccccceeEEEeeeE
Confidence            99999999999999999999999999999    9999999999876         2   5789998655


No 3  
>PF01789 PsbP:  PsbP;  InterPro: IPR002683 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  In PSII, the oxygen-evolving complex (OEC) is responsible for catalysing the splitting of water to O(2) and 4H+. The OEC is composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ), PsbU and PsbV having been lost during the evolution of green plants []. This family represents the PSII OEC protein PsbP. Both PsbP and PsbQ (IPR008797 from INTERPRO) are regulators that are necessary for the biogenesis of optically active PSII. PsbP increases the affinity of the water oxidation site for chloride ions and provides the conditions required for high affinity binding of calcium ions [, ]. The crystal structure of PsbP from Nicotiana tabacum (Common tobacco) revealed a two-domain structure, where domain 1 may play a role in the ion retention activity in PSII, the N-terminal residues being essential for calcium and chloride ion retention activity []. PsbP is encoded in the nuclear genome in plants.; GO: 0005509 calcium ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0019898 extrinsic to membrane; PDB: 2VU4_A 1V2B_A 2LNJ_A 2XB3_A.
Probab=99.90  E-value=4.2e-24  Score=176.10  Aligned_cols=97  Identities=37%  Similarity=0.617  Sum_probs=82.0

Q ss_pred             CCcccccccccCceeeeeCCCCeEEeecCCceeeeecCcceeecCCCCCCcceEEEEecCCCC-CcccCCCHHHHHHHHH
Q 028758           83 TPPSFAAESNKGFLSVTDKKDGYSFVYPFGWQEVIIEGQDKVFKDVIEPLESVSVNLIPTGKQ-DIRDFGPPQEVCSIFS  161 (204)
Q Consensus        83 a~~A~Ae~~~~Gf~~Y~D~~dGYsFlyP~gW~ev~~~G~dv~F~D~~~~~eNVSVvVsp~~~~-sI~dlGsPeeVae~L~  161 (204)
                      +..+.++...+||++|.|+++||+|.||.+|+++++.|+|++|+|+++.++||+|+|+|+.+. +|+|||+|+|||++|+
T Consensus        11 ~~~~~~~~~~~~~~~y~d~~~~y~f~~P~gW~~~~~~G~~v~f~d~~~~~~nvsV~v~p~~~~~sl~~lGs~~~va~~l~   90 (175)
T PF01789_consen   11 ANVACAAEASTGFQPYTDSDDGYSFLYPSGWEEVDVSGADVVFRDPIDADENVSVVVSPVPKDFSLEDLGSPEEVAERLL   90 (175)
T ss_dssp             -----STT--SSEEEEEECTTTEEEEEETTEEEEESTTEEEEEEETTETTSEEEEEEEE-STS-SGGGG-SHHHHHHHHH
T ss_pred             chhhhcccCCCCceEEEcCCCCEEEECCCCCeecCCCCeEEEEECcccccceEEEEEEecCCcCchhhcCCHHHHHHHHh
Confidence            334445667899999999999999999999999999999999999999999999999999855 9999999999999999


Q ss_pred             hhhhcCCC---ceeeecchhh
Q 028758          162 SAIFFIHN---KTEIYDPFYA  179 (204)
Q Consensus       162 kq~~a~p~---~a~Lida~~~  179 (204)
                      ++.+++++   +++||++..+
T Consensus        91 ~~~~~~~~~~~~a~li~a~~~  111 (175)
T PF01789_consen   91 NGELASPGSGREAELISASER  111 (175)
T ss_dssp             HHCCCHCTSSEEEEEEEEEEE
T ss_pred             hhhcccccCCcceEEEEeeee
Confidence            99998877   8899887654


No 4  
>PLN00066 PsbP domain-containing protein 4; Provisional
Probab=99.86  E-value=2.1e-21  Score=171.78  Aligned_cols=120  Identities=20%  Similarity=0.340  Sum_probs=98.2

Q ss_pred             cCccchHHHHHHHHHHhhhhhcCCCCccc--------------ccccccCceeeeeCCC-------------CeEEeecC
Q 028758           59 LDKCGRRQMIAVGVIAPWVSLVNQTPPSF--------------AAESNKGFLSVTDKKD-------------GYSFVYPF  111 (204)
Q Consensus        59 ~~~~~RR~aL~~~a~Aa~~s~~~~a~~A~--------------Ae~~~~Gf~~Y~D~~d-------------GYsFlyP~  111 (204)
                      ...++||.+|+.+++++..+.++.+..++              .|++..||++|..+..             .|+|+||.
T Consensus        42 ~~~~~rr~~~~s~~~~~~~~~~~~~~~~~a~~~g~~ag~~~~~s~~~~~g~~~~~rp~~~~Gg~G~~~~~i~~Y~F~yP~  121 (262)
T PLN00066         42 ATAVSRRSALASGAAAASSAVLAFPGEGLAVKQGLLAGRVPGLSEPDENGWRTYRRPEGKSGGHGVGWSEITPYSFKVPQ  121 (262)
T ss_pred             cchhhHHHHHHHHHHHHhhhhhcCCcchhhhhhcccccCCCCCCCccccceEEEecCccccCcCCCCccccCCeEEECCC
Confidence            45678999998776654443343333333              2556789999998876             49999999


Q ss_pred             Cceeeeec-----CcceeecCCCCCCcceEEEEecC--------CCCCcccCCCHHHHHHHHHhhhhcCCC-ceeeecch
Q 028758          112 GWQEVIIE-----GQDKVFKDVIEPLESVSVNLIPT--------GKQDIRDFGPPQEVCSIFSSAIFFIHN-KTEIYDPF  177 (204)
Q Consensus       112 gW~ev~~~-----G~dv~F~D~~~~~eNVSVvVsp~--------~~~sI~dlGsPeeVae~L~kq~~a~p~-~a~Lida~  177 (204)
                      ||.|+.++     |+++.||+.++.++||+|+|+|+        ++++|+|||+||+|++.|++++++++. +++|+++.
T Consensus       122 GW~ev~VS~~d~gg~~vd~Rf~~~~~~nvsVvVspv~rla~~~~~~~sI~dLGspeeVi~~l~~~v~g~~~~e~eLl~a~  201 (262)
T PLN00066        122 GWEEVPVSIADLGGTEIDLRFASDKEGRLKVVVAPVLRFADNLGDNATIEEIGPPEKVISGFGPELIGEPVEEGKVLSME  201 (262)
T ss_pred             CCeEeecccccCCCCceEEEeccCCCccEEEEEeccccccccccCCCChHHcCCHHHHHHHHHHHhcCCCccccceeEee
Confidence            99999887     66777777778999999999997        589999999999999999999999988 99999986


Q ss_pred             h
Q 028758          178 Y  178 (204)
Q Consensus       178 ~  178 (204)
                      .
T Consensus       202 ~  202 (262)
T PLN00066        202 V  202 (262)
T ss_pred             e
Confidence            5


No 5  
>PLN00067 PsbP domain-containing protein 6; Provisional
Probab=99.84  E-value=9.9e-21  Score=167.16  Aligned_cols=121  Identities=18%  Similarity=0.311  Sum_probs=92.5

Q ss_pred             cCccCccchHHHHHHHHHHhhhhhcCCCCcccc-c----------ccccCceeeeeC-----------CCCeEEeecCCc
Q 028758           56 ANSLDKCGRRQMIAVGVIAPWVSLVNQTPPSFA-A----------ESNKGFLSVTDK-----------KDGYSFVYPFGW  113 (204)
Q Consensus        56 s~~~~~~~RR~aL~~~a~Aa~~s~~~~a~~A~A-e----------~~~~Gf~~Y~D~-----------~dGYsFlyP~gW  113 (204)
                      ++....+.||+.|..++.+.+.+.+... ++.| |          +...||.-|.-.           -.||+|+||.||
T Consensus        37 ~~~~~~~~rr~~~~~~~~~~~~~~~~~~-~~~~~~~~v~~~lp~~~~~~~~~~f~~~~~~tpalra~~i~gY~FlyP~gW  115 (263)
T PLN00067         37 PRAAVVIHRRELLLGLALAPLILIAPEP-PAEAREVEVGSYLPPSPSDPSFVLFKASPKDTPALRAGNVQPYQFILPPTW  115 (263)
T ss_pred             ccccchhHHHHHHhhhhhhhhhhccCCc-hhhhheehhhcccCCCCCCCceEEEecCCCCCcccccCCcccceEeCCCCC
Confidence            3455567899998766655544443222 3333 2          224577777532           238999999999


Q ss_pred             eeeeec----C-----------cceeecCCCCCCcceEEEEecC------CCCCcccCCCHHHHHHHHHhhhhcCCC-ce
Q 028758          114 QEVIIE----G-----------QDKVFKDVIEPLESVSVNLIPT------GKQDIRDFGPPQEVCSIFSSAIFFIHN-KT  171 (204)
Q Consensus       114 ~ev~~~----G-----------~dv~F~D~~~~~eNVSVvVsp~------~~~sI~dlGsPeeVae~L~kq~~a~p~-~a  171 (204)
                      ++++++    |           +|++|+|++  ++||+|+|+|+      ++++|+|||+||||+++|++.++++++ ++
T Consensus       116 ~~v~Vs~~~sGnycqp~c~~p~~dv~F~D~~--dgnVSVIVSPV~r~t~k~~~sIeDlGsPeeVl~~Lg~~v~g~~~~~~  193 (263)
T PLN00067        116 KQTRVANILSGNYCQPKCAEPWVEVKFEDEK--QGKVQVVASPLIRLTNKPNATIEEIGSPEKLIASLGPFVTGNSYDPD  193 (263)
T ss_pred             cCccccccccCccccccccCCCceEEEeCCC--CCCEEEEEecccccccCCCCChHHccCHHHHHHHhhHHhhcCCCCCc
Confidence            998886    4           899999955  78999999997      468999999999999999999999888 89


Q ss_pred             eeecchhh
Q 028758          172 EIYDPFYA  179 (204)
Q Consensus       172 ~Lida~~~  179 (204)
                      +||++..+
T Consensus       194 eLLeAs~r  201 (263)
T PLN00067        194 ELLETSVE  201 (263)
T ss_pred             ceEEeeeE
Confidence            99998755


No 6  
>PLN03152 hypothetical protein; Provisional
Probab=98.87  E-value=3.2e-09  Score=92.96  Aligned_cols=99  Identities=28%  Similarity=0.415  Sum_probs=68.7

Q ss_pred             CccchHHHHHHHHHHhhhh--hcCCCCccccccc------------ccCceeeeeCCCCeEEeecCCceeee----ec-C
Q 028758           60 DKCGRRQMIAVGVIAPWVS--LVNQTPPSFAAES------------NKGFLSVTDKKDGYSFVYPFGWQEVI----IE-G  120 (204)
Q Consensus        60 ~~~~RR~aL~~~a~Aa~~s--~~~~a~~A~Ae~~------------~~Gf~~Y~D~~dGYsFlyP~gW~ev~----~~-G  120 (204)
                      +...||+.+.-.++++..+  .-.+...++|+..            .+.|-.|  .++||+.-||-+++.+-    +. |
T Consensus        29 ~~~~~r~~~~~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~nt~~w~~~--~g~gf~~~~pp~f~di~e~~~~~~g  106 (241)
T PLN03152         29 CGASRRDFILHTASLCASSLAAQNPLPPSLADPSKPSKPLLSGIANTKSWFQF--YGDGFSIRVPPSFEDIMEPEDYNAG  106 (241)
T ss_pred             ccccccceeeehhHHHHhhhhcCCCCCccccCCCCCCCchheeeecchhhhhh--hCCceEEeCCCChhhhcChhhcccc
Confidence            3556888875444444333  3333445666532            3456667  59999999999998532    11 2


Q ss_pred             ------------cceeecCCCCCCcceEEEEecC--------CCCCcccCCCHHHHHHHHH
Q 028758          121 ------------QDKVFKDVIEPLESVSVNLIPT--------GKQDIRDFGPPQEVCSIFS  161 (204)
Q Consensus       121 ------------~dv~F~D~~~~~eNVSVvVsp~--------~~~sI~dlGsPeeVae~L~  161 (204)
                                  -.++|..+ |.+|||||+|+|+        +.++|+|||+|+|||+.|+
T Consensus       107 ~~~yg~~akp~~~~aRf~s~-D~sEnVSVVIspv~~LK~tfle~kDLtDLGsp~EVgkv~v  166 (241)
T PLN03152        107 LSLYGDKAKPRTFAARFASP-DGSEVLSVVIRPSNQLKITFLEAKDITDLGSLKEAAKIFV  166 (241)
T ss_pred             cceecCCCCCcceeeeecCC-CCCceEEEEEecCccccccccccCChhHcCCHHHHHHhhC
Confidence                        13566665 7799999999997        5899999999999997776


No 7  
>PF12712 DUF3805:  Domain of unknown function (DUF3805);  InterPro: IPR024315 This entry represents an N-terminal domain found in a family of bacterial proteins, whose function is unknown. In two related Bacteroides species, the gene for members of this family lies immediately upstream from a putative ATP binding component of an ATP transporter and a putative histidinol phosphatase. The structure of this domain is strikingly similar to the N-terminal structure of 1tui, also of unknown function. The domain carries four conserved tryptophan residues.; PDB: 3HLZ_A.
Probab=89.43  E-value=0.52  Score=39.34  Aligned_cols=45  Identities=16%  Similarity=0.272  Sum_probs=26.6

Q ss_pred             eeeeeCCCCeEEeecCCceeeeecCc-ceeecCCCCCCcceEEEEec
Q 028758           96 LSVTDKKDGYSFVYPFGWQEVIIEGQ-DKVFKDVIEPLESVSVNLIP  141 (204)
Q Consensus        96 ~~Y~D~~dGYsFlyP~gW~ev~~~G~-dv~F~D~~~~~eNVSVvVsp  141 (204)
                      +.|..|+.=|+..||.+|.|.+ +|- ...|-|+..=+.|..+..-.
T Consensus         2 kKfiSpg~WFS~~YP~~W~EfE-D~E~sflFYnp~~WTGNfRISayk   47 (153)
T PF12712_consen    2 KKFISPGAWFSMEYPADWNEFE-DGEGSFLFYNPDQWTGNFRISAYK   47 (153)
T ss_dssp             EEEE-GGG-EEEEE-TT-EEE----TTEEEEE-SSS---EEEEEEEE
T ss_pred             CcccCCCceEEEecCCCcchhc-cCCcceEEEChHHhcCceEEEEEe
Confidence            5688888899999999999998 544 34578888889998866544


No 8  
>PF10518 TAT_signal:  TAT (twin-arginine translocation) pathway signal sequence;  InterPro: IPR019546 The twin-arginine translocation (Tat) pathway serves the role of transporting folded proteins across energy-transducing membranes []. Homologues of the genes that encode the transport apparatus occur in archaea, bacteria, chloroplasts, and plant mitochondria []. In bacteria, the Tat pathway catalyses the export of proteins from the cytoplasm across the inner/cytoplasmic membrane. In chloroplasts, the Tat components are found in the thylakoid membrane and direct the import of proteins from the stroma. The Tat pathway acts separately from the general secretory (Sec) pathway, which transports proteins in an unfolded state []. It is generally accepted that the primary role of the Tat system is to translocate fully folded proteins across membranes. An example of proteins that need to be exported in their 3D conformation are redox proteins that have acquired complex multi-atom cofactors in the bacterial cytoplasm (or the chloroplast stroma or mitochondrial matrix). They include hydrogenases, formate dehydrogenases, nitrate reductases, trimethylamine N-oxide (TMAO) reductases and dimethyl sulphoxide (DMSO) reductases [, ]. The Tat system can also export whole heteroligomeric complexes in which some proteins have no Tat signal. This is the case of the DMSO reductase or formate dehydrogenase complexes. But there are also other cases where the physiological rationale for targeting a protein to the Tat signal is less obvious. Indeed, there are examples of homologous proteins that are in some cases targeted to the Tat pathway and in other cases to the Sec apparatus. Some examples are: copper nitrite reductases, flavin domains of flavocytochrome c and N-acetylmuramoyl-L-alanine amidases []. In halophilic archaea such as Halobacterium almost all secreted proteins appear to be Tat targeted. It has been proposed to be a response to the difficulties these organisms would otherwise face in successfully folding proteins extracellularly at high ionic strength []. The Tat signal peptide consists of three motifs: the positively charged N-terminal motif, the hydrophobic region and the C-terminal region that generally ends with a consensus short motif (A-x-A) specifying cleavage by signal peptidase. Sequence analysis revealed that signal peptides capable of targeting the Tat protein contain the consensus sequence [ST]-R-R-x-F-L-K. The nearly invariant twin-arginine gave rise to the pathway's name. In addition the h-region of Tat signal peptides is typically less hydrophobic than that of Sec-specific signal peptides [, ]. 
Probab=56.27  E-value=14  Score=21.96  Aligned_cols=12  Identities=33%  Similarity=0.490  Sum_probs=9.0

Q ss_pred             cchHHHHHHHHH
Q 028758           62 CGRRQMIAVGVI   73 (204)
Q Consensus        62 ~~RR~aL~~~a~   73 (204)
                      ++||+.|-.+++
T Consensus         2 ~sRR~fLk~~~a   13 (26)
T PF10518_consen    2 LSRRQFLKGGAA   13 (26)
T ss_pred             CcHHHHHHHHHH
Confidence            579999965544


No 9  
>TIGR02811 formate_TAT formate dehydrogenase region TAT target. Members of this uncharacterized protein family are all small, extending 70 or fewer residues from their respective likely start codons. All have the twin-arginine-dependent tranport (TAT) signal sequence at the N-terminus and a conserved 20-residue C-terminal region that includes the motif Y-[HRK]-X-[TS]-X-H-[IV]-X-X-[YF]-Y. The TAT signal sequence suggests a bound cofactor. All members are encoded near genes for subunits of formate dehydrogenase, and may themselves be a subunit or accessory protein.
Probab=54.02  E-value=18  Score=26.14  Aligned_cols=11  Identities=18%  Similarity=0.332  Sum_probs=8.2

Q ss_pred             cCccchHHHHH
Q 028758           59 LDKCGRRQMIA   69 (204)
Q Consensus        59 ~~~~~RR~aL~   69 (204)
                      +...+||..|.
T Consensus         6 ~~~~sRR~Flk   16 (66)
T TIGR02811         6 KADPSRRDLLK   16 (66)
T ss_pred             cCCccHHHHHH
Confidence            44668999994


No 10 
>PF07174 FAP:  Fibronectin-attachment protein (FAP);  InterPro: IPR010801 This family contains bacterial fibronectin-attachment proteins (FAP). Family members are rich in alanine and proline, are approximately 300 long, and seem to be restricted to mycobacteria. These proteins contain a fibronectin-binding motif that allows mycobacteria to bind to fibronectin in the extracellular matrix [].; GO: 0050840 extracellular matrix binding, 0005576 extracellular region
Probab=53.36  E-value=31  Score=31.90  Aligned_cols=66  Identities=23%  Similarity=0.278  Sum_probs=37.6

Q ss_pred             eeeeeCCCCeEEeecCCceeeeec----CcceeecCCC--------CCCcc-eEEEEecCC---CCCcccCCCHHHHHHH
Q 028758           96 LSVTDKKDGYSFVYPFGWQEVIIE----GQDKVFKDVI--------EPLES-VSVNLIPTG---KQDIRDFGPPQEVCSI  159 (204)
Q Consensus        96 ~~Y~D~~dGYsFlyP~gW~ev~~~----G~dv~F~D~~--------~~~eN-VSVvVsp~~---~~sI~dlGsPeeVae~  159 (204)
                      -++.|...||+|++|.||.+-+-.    |+.+.-+-..        .+..| -+|++-..|   +.+.|  -+-.+.+.+
T Consensus       110 grvdn~~gGFS~vvP~GW~~Sda~~L~yG~alls~~~~~~~~~~~~~p~andt~v~lgrld~kl~a~ae--~dn~kaa~r  187 (297)
T PF07174_consen  110 GRVDNAAGGFSYVVPAGWVESDASHLDYGSALLSKQTGEPPMPGQPPPVANDTSVVLGRLDLKLFASAE--PDNTKAAVR  187 (297)
T ss_pred             ccccccccceEEeccCCccccccceeecceeeeccCCCCCCCCCCCCCcCCCceEEecccccccccccc--CChHHHHHH
Confidence            356677889999999999965432    5554443222        22233 344444454   11211  234558888


Q ss_pred             HHhh
Q 028758          160 FSSA  163 (204)
Q Consensus       160 L~kq  163 (204)
                      |...
T Consensus       188 l~sd  191 (297)
T PF07174_consen  188 LASD  191 (297)
T ss_pred             Hhcc
Confidence            8775


No 11 
>PF08006 DUF1700:  Protein of unknown function (DUF1700);  InterPro: IPR012963 This family contains many hypothetical bacterial proteins and two putative membrane proteins (Q6GFD0 from SWISSPROT and Q6G806 from SWISSPROT).
Probab=52.04  E-value=8.4  Score=31.76  Aligned_cols=20  Identities=20%  Similarity=0.429  Sum_probs=17.1

Q ss_pred             CCcccCCCHHHHHHHHHhhh
Q 028758          145 QDIRDFGPPQEVCSIFSSAI  164 (204)
Q Consensus       145 ~sI~dlGsPeeVae~L~kq~  164 (204)
                      .=+++||+|+|+|..+..++
T Consensus        45 eii~~LG~P~~iA~~i~~~~   64 (181)
T PF08006_consen   45 EIIAELGSPKEIAREILAEY   64 (181)
T ss_pred             HHHHHcCCHHHHHHHHHHhh
Confidence            45789999999999998764


No 12 
>PLN00058 photosystem II reaction center subunit T; Provisional
Probab=33.66  E-value=32  Score=27.17  Aligned_cols=21  Identities=24%  Similarity=0.230  Sum_probs=14.8

Q ss_pred             cCccchHHHHHHHHHHhhhhh
Q 028758           59 LDKCGRRQMIAVGVIAPWVSL   79 (204)
Q Consensus        59 ~~~~~RR~aL~~~a~Aa~~s~   79 (204)
                      ++..+||.+|-..++++..+.
T Consensus        46 e~~~gRR~~mfaaaAaav~s~   66 (103)
T PLN00058         46 QSTTMRRDLMFTAAAAAVCSL   66 (103)
T ss_pred             cchhhHHHHHHHHHHHHHHhh
Confidence            467789999976666555554


No 13 
>PF12559 Inhibitor_I10:  Serine endopeptidase inhibitors;  InterPro: IPR022217  This family includes both microviridins and marinostatins. It seems likely that in both cases it is the C terminus which becomes the active inhibitor after post-translational modifications of the full length, pre-peptide. it is the ester linkages within the key, 12-residue. region that circularise the molecule giving it its inhibitory conformation. ; PDB: 1IXU_A.
Probab=32.87  E-value=16  Score=25.98  Aligned_cols=12  Identities=33%  Similarity=0.772  Sum_probs=4.0

Q ss_pred             CeEEeecCCcee
Q 028758          104 GYSFVYPFGWQE  115 (204)
Q Consensus       104 GYsFlyP~gW~e  115 (204)
                      ..+..||++|.+
T Consensus        44 ~~TlKyPSD~ee   55 (56)
T PF12559_consen   44 IQTLKYPSDWEE   55 (56)
T ss_dssp             -----SS-SS--
T ss_pred             CcceeCCCcccc
Confidence            379999999975


No 14 
>PRK11615 hypothetical protein; Provisional
Probab=29.97  E-value=2.4e+02  Score=24.57  Aligned_cols=72  Identities=17%  Similarity=0.158  Sum_probs=40.7

Q ss_pred             cccccccccCceeeeeCCCCeEEeecCCceeeeec-Cc----ceeecCCCCCCcceEEEEecCCCCCcccCCCHHHHHHH
Q 028758           85 PSFAAESNKGFLSVTDKKDGYSFVYPFGWQEVIIE-GQ----DKVFKDVIEPLESVSVNLIPTGKQDIRDFGPPQEVCSI  159 (204)
Q Consensus        85 ~A~Ae~~~~Gf~~Y~D~~dGYsFlyP~gW~ev~~~-G~----dv~F~D~~~~~eNVSVvVsp~~~~sI~dlGsPeeVae~  159 (204)
                      .+.|++...| +...=-+.+.+|..|.|+.....+ |.    --+|-|.   .+.=.|+|++-| .+=++   -+..+.+
T Consensus        31 ~~~a~~~~~~-q~VSLLdGKl~FtLPag~sdqsgk~Gtq~nn~~vYad~---tg~kavIVi~gD-~~~~~---Ld~la~r  102 (185)
T PRK11615         31 GAVAESNASG-QPVSLLDGKLSFTLPADMSDQSGKLGTQANNMHVYADA---TGQKAVIVILGD-DTNED---LAVLAKR  102 (185)
T ss_pred             cccccccccC-ceeEEeccEEEEEcCCccccccccccccccceEEEEcC---CCCEEEEEEeCC-CChhh---HHHHHHH
Confidence            3444444444 334335677999999999976554 42    3457663   344455555433 11112   3557778


Q ss_pred             HHhhh
Q 028758          160 FSSAI  164 (204)
Q Consensus       160 L~kq~  164 (204)
                      |..|-
T Consensus       103 l~~qQ  107 (185)
T PRK11615        103 LEDQQ  107 (185)
T ss_pred             HHHHH
Confidence            87763


No 15 
>PF10399 UCR_Fe-S_N:  Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal;  InterPro: IPR019470  This entry represents the TAT-signal region found in the iron-sulphur subunit of Ubiquinol-cytochrome C reductase (also known as the cytochrome bc1 complex). This enzymex is an oligomeric membrane protein complex that is a component of respiratory and photosynthetic electron transfer chains. It couples the transfer of electrons from ubiquinol to cytochrome c with the generation of a protein gradient across the membrane []. This entry is associated with IPR017941 from INTERPRO, IPR004192 from INTERPRO and IPR015248 from INTERPRO. ; GO: 0008121 ubiquinol-cytochrome-c reductase activity, 0055114 oxidation-reduction process; PDB: 1ZRT_R 2QJY_R 2FYN_L 2QJK_O 2QJP_I 2YIU_F.
Probab=29.74  E-value=45  Score=22.08  Aligned_cols=15  Identities=20%  Similarity=0.313  Sum_probs=6.6

Q ss_pred             CccCccchHHHHHHH
Q 028758           57 NSLDKCGRRQMIAVG   71 (204)
Q Consensus        57 ~~~~~~~RR~aL~~~   71 (204)
                      .+....+||..|...
T Consensus         4 ~~~~~~~RRdFL~~a   18 (41)
T PF10399_consen    4 NEPVDPTRRDFLTIA   18 (41)
T ss_dssp             ------HHHHHHHHH
T ss_pred             CCCCCchHHHHHHHH
Confidence            345567899998433


No 16 
>PRK10882 hydrogenase 2 protein HybA; Provisional
Probab=29.30  E-value=79  Score=29.34  Aligned_cols=13  Identities=15%  Similarity=0.332  Sum_probs=8.7

Q ss_pred             cchHHHHHHHHHH
Q 028758           62 CGRRQMIAVGVIA   74 (204)
Q Consensus        62 ~~RR~aL~~~a~A   74 (204)
                      +.||..|..+++|
T Consensus         1 ~~RR~fl~~~~~~   13 (328)
T PRK10882          1 MNRRNFLKAASAG   13 (328)
T ss_pred             CCHHHHHHHHHHH
Confidence            4699999654433


No 17 
>cd04458 CSP_CDS Cold-Shock Protein (CSP) contains an S1-like cold-shock domain (CSD) that is found in eukaryotes, prokaryotes, and archaea.  CSP's include the major cold-shock proteins CspA and CspB in bacteria and the eukaryotic gene regulatory factor Y-box protein. CSP expression is up-regulated by an abrupt drop in growth temperature. CSP's are also expressed under normal condition at lower level. The function of cold-shock proteins is not fully understood. They preferentially bind poly-pyrimidine region of single-stranded RNA and DNA.  CSP's are thought to bind mRNA and regulate ribosomal translation, mRNA degradation, and  the rate of transcription termination. The human Y-box protein, which contains a CSD, regulates transcription and translation of genes that contain the Y-box sequence in their promoters. This specific ssDNA-binding properties of CSD are required for the binding of Y-box protein to the promoter's Y-box sequence, thereby regulating transcription.
Probab=28.71  E-value=81  Score=21.44  Aligned_cols=27  Identities=26%  Similarity=0.534  Sum_probs=19.3

Q ss_pred             CceeeeeCCCCeEEeecCCceeeeecCcceeec
Q 028758           94 GFLSVTDKKDGYSFVYPFGWQEVIIEGQDKVFK  126 (204)
Q Consensus        94 Gf~~Y~D~~dGYsFlyP~gW~ev~~~G~dv~F~  126 (204)
                      |-....|+..||-|+-|.+      .|.|++|+
T Consensus         3 G~Vk~~~~~kGfGFI~~~~------~g~diffh   29 (65)
T cd04458           3 GTVKWFDDEKGFGFITPDD------GGEDVFVH   29 (65)
T ss_pred             EEEEEEECCCCeEEEecCC------CCcCEEEE
Confidence            4445667889999998887      35666654


No 18 
>PRK10943 cold shock-like protein CspC; Provisional
Probab=28.61  E-value=67  Score=22.92  Aligned_cols=20  Identities=25%  Similarity=0.567  Sum_probs=16.7

Q ss_pred             cCceeeeeCCCCeEEeecCC
Q 028758           93 KGFLSVTDKKDGYSFVYPFG  112 (204)
Q Consensus        93 ~Gf~~Y~D~~dGYsFlyP~g  112 (204)
                      .|.-..-|...||-|+-|.+
T Consensus         5 ~G~Vk~f~~~kGfGFI~~~~   24 (69)
T PRK10943          5 KGQVKWFNESKGFGFITPAD   24 (69)
T ss_pred             ceEEEEEeCCCCcEEEecCC
Confidence            56777788999999999975


No 19 
>TIGR03741 PRTRC_E PRTRC system protein E. A novel genetic system characterized by six or seven major proteins, included a ParB homolog and a ThiF homolog, is designated PRTRC, or ParB-Related,ThiF-Related Cassette. It is often found on plasmids. This protein family averages about 150 amino acids in length, but the last third contains low-complexity sequence that complicates sequence comparisons. This model does not include the low-complexity region.
Probab=26.63  E-value=1.1e+02  Score=24.20  Aligned_cols=34  Identities=26%  Similarity=0.371  Sum_probs=23.9

Q ss_pred             cceEEEEecCCCCCc--cc-------CCCHHHHHHHHHhhhhc
Q 028758          133 ESVSVNLIPTGKQDI--RD-------FGPPQEVCSIFSSAIFF  166 (204)
Q Consensus       133 eNVSVvVsp~~~~sI--~d-------lGsPeeVae~L~kq~~a  166 (204)
                      +++.|.|.|..+...  ..       -|+|+|..+.|...+-.
T Consensus        24 d~l~V~v~P~~~~~~~d~~l~~Pl~L~gTp~ELD~gF~~ai~~   66 (104)
T TIGR03741        24 DKLTVTVTPTPKSGAKDGALTKPLVLTGTPAELDAGFAGALGQ   66 (104)
T ss_pred             CEEEEEEeeccccccccccccCCeeeccCHHHHHHHHHHHHHh
Confidence            389999999742222  33       49999999888866543


No 20 
>COG4784 Putative Zn-dependent protease [General function prediction only]
Probab=24.84  E-value=53  Score=31.73  Aligned_cols=37  Identities=14%  Similarity=0.247  Sum_probs=27.9

Q ss_pred             CCcccccccccCce---eeeeCCCCeEEeecCCceeeeec
Q 028758           83 TPPSFAAESNKGFL---SVTDKKDGYSFVYPFGWQEVIIE  119 (204)
Q Consensus        83 a~~A~Ae~~~~Gf~---~Y~D~~dGYsFlyP~gW~ev~~~  119 (204)
                      -..-|+..+.+||.   .|.-++=|++|.||.||.-....
T Consensus       272 dg~lyGDSp~eGyvRgq~FlH~~Lg~tf~~P~Gf~IdN~~  311 (479)
T COG4784         272 DGLLYGDSPQEGYVRGQTFLHPELGVTFDVPDGFKIDNSA  311 (479)
T ss_pred             cCcccCCCcccceecccceeccccceEEecCCceEecCch
Confidence            33456677778885   57778889999999999865543


No 21 
>PLN00054 photosystem I reaction center subunit N; Provisional
Probab=24.62  E-value=80  Score=26.20  Aligned_cols=15  Identities=20%  Similarity=0.051  Sum_probs=9.9

Q ss_pred             cCccchHHHHHHHHH
Q 028758           59 LDKCGRRQMIAVGVI   73 (204)
Q Consensus        59 ~~~~~RR~aL~~~a~   73 (204)
                      ...-+||.+|..+++
T Consensus        25 ~~~~grraa~~~Laa   39 (139)
T PLN00054         25 DASDGRRAALVGLAA   39 (139)
T ss_pred             ccccchHHHHHHHHH
Confidence            344569999876554


No 22 
>TIGR02381 cspD cold shock domain protein CspD. This model represents what appears to be a phylogenetically distinct clade, containing E. coli CspD and related proteobacterial proteins within the larger family of cold shock domain proteins described by pfam model pfam00313. The gene symbol cspD may have been used idependently for other subfamilies of cold shock domain proteins, such as for B. subtilis CspD. These proteins typically are shorter than 70 amino acids. In E. coli, CspD is a stress response protein induced in stationary phase. This homodimer binds single-stranded DNA and appears to inhibit DNA replication.
Probab=22.32  E-value=1.2e+02  Score=21.49  Aligned_cols=20  Identities=25%  Similarity=0.629  Sum_probs=16.3

Q ss_pred             cCceeeeeCCCCeEEeecCC
Q 028758           93 KGFLSVTDKKDGYSFVYPFG  112 (204)
Q Consensus        93 ~Gf~~Y~D~~dGYsFlyP~g  112 (204)
                      .|-..+.|...||-|+-|.+
T Consensus         3 ~G~Vk~f~~~kGfGFI~~~~   22 (68)
T TIGR02381         3 IGIVKWFNNAKGFGFICPEG   22 (68)
T ss_pred             CeEEEEEeCCCCeEEEecCC
Confidence            36667778999999999985


No 23 
>PRK09937 stationary phase/starvation inducible regulatory protein CspD; Provisional
Probab=21.67  E-value=1.2e+02  Score=22.08  Aligned_cols=20  Identities=30%  Similarity=0.664  Sum_probs=15.9

Q ss_pred             cCceeeeeCCCCeEEeecCC
Q 028758           93 KGFLSVTDKKDGYSFVYPFG  112 (204)
Q Consensus        93 ~Gf~~Y~D~~dGYsFlyP~g  112 (204)
                      .|-..+-|...||-|+-|.+
T Consensus         3 ~G~Vkwfn~~KGfGFI~~~~   22 (74)
T PRK09937          3 KGTVKWFNNAKGFGFICPEG   22 (74)
T ss_pred             CeEEEEEeCCCCeEEEeeCC
Confidence            35566778899999999975


No 24 
>PLN02729 PSII-Q subunit
Probab=21.57  E-value=49  Score=29.46  Aligned_cols=27  Identities=26%  Similarity=0.198  Sum_probs=16.0

Q ss_pred             ccchHHHHHHHHHHhh-hhhcCCCCcccccc
Q 028758           61 KCGRRQMIAVGVIAPW-VSLVNQTPPSFAAE   90 (204)
Q Consensus        61 ~~~RR~aL~~~a~Aa~-~s~~~~a~~A~Ae~   90 (204)
                      ..+||.+|+..+++.. .+.   +.+++||.
T Consensus        49 ~~~rr~~lgl~a~~l~~~s~---~~~~~A~~   76 (220)
T PLN02729         49 QTTRRLALGLASIALIGNSG---NGVSLAED   76 (220)
T ss_pred             hhhHHHHHHHHHHHHhcchh---hhHHHhcc
Confidence            4579999976654332 223   44567763


No 25 
>PF05757 PsbQ:  Oxygen evolving enhancer protein 3 (PsbQ);  InterPro: IPR008797 Oxygenic photosynthesis uses two multi-subunit photosystems (I and II) located in the cell membranes of cyanobacteria and in the thylakoid membranes of chloroplasts in plants and algae. Photosystem II (PSII) has a P680 reaction centre containing chlorophyll 'a' that uses light energy to carry out the oxidation (splitting) of water molecules, and to produce ATP via a proton pump. Photosystem I (PSI) has a P700 reaction centre containing chlorophyll that takes the electron and associated hydrogen donated from PSII to reduce NADP+ to NADPH. Both ATP and NADPH are subsequently used in the light-independent reactions to convert carbon dioxide to glucose using the hydrogen atom extracted from water by PSII, releasing oxygen as a by-product. PSII is a multisubunit protein-pigment complex containing polypeptides both intrinsic and extrinsic to the photosynthetic membrane [, ]. Within the core of the complex, the chlorophyll and beta-carotene pigments are mainly bound to the antenna proteins CP43 (PsbC) and CP47 (PsbB), which pass the excitation energy on to the reaction centre proteins D1 (Qb, PsbA) and D2 (Qa, PsbD) that bind all the redox-active cofactors involved in the energy conversion process. The PSII oxygen-evolving complex (OEC) oxidises water to provide protons for use by PSI, and consists of OEE1 (PsbO), OEE2 (PsbP) and OEE3 (PsbQ). The remaining subunits in PSII are of low molecular weight (less than 10 kDa), and are involved in PSII assembly, stabilisation, dimerisation, and photo-protection [].  In PSII, the oxygen-evolving complex (OEC) is responsible for catalysing the splitting of water to O(2) and 4H+. The OEC is composed of a cluster of manganese, calcium and chloride ions bound to extrinsic proteins. In cyanobacteria there are five extrinsic proteins in OEC (PsbO, PsbP-like, PsbQ-like, PsbU and PsbV), while in plants there are only three (PsbO, PsbP and PsbQ), PsbU and PsbV having been lost during the evolution of green plants []. This family represents the PSII OEC protein PsbQ. Both PsbQ and PsbP (IPR002683 from INTERPRO) are regulators that are necessary for the biogenesis of optically active PSII. The crystal structure of PsbQ from spinach revealed a 4-helical bundle polypeptide. The distribution of positive and negative charges on the protein surface might explain the ability of PsbQ to increase the binding of chloride and calcium ions and make them available to PSII [].; GO: 0005509 calcium ion binding, 0015979 photosynthesis, 0009523 photosystem II, 0009654 oxygen evolving complex, 0019898 extrinsic to membrane; PDB: 1VYK_A 1NZE_A 3LS1_A 3LS0_A.
Probab=20.90  E-value=34  Score=29.87  Aligned_cols=16  Identities=13%  Similarity=0.241  Sum_probs=0.0

Q ss_pred             ccCccchHHHHHHHHH
Q 028758           58 SLDKCGRRQMIAVGVI   73 (204)
Q Consensus        58 ~~~~~~RR~aL~~~a~   73 (204)
                      .+...+||.+|+.+++
T Consensus        25 ~~~~~~RRa~l~~l~a   40 (202)
T PF05757_consen   25 AQQQTSRRAVLGSLLA   40 (202)
T ss_dssp             ----------------
T ss_pred             ccccccHHHHHHHHHH
Confidence            4556779999884544


Done!