Query         028769
Match_columns 204
No_of_seqs    131 out of 144
Neff          4.8 
Searched_HMMs 46136
Date          Fri Mar 29 16:42:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028769.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028769hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3136 Uncharacterized conser 100.0 6.4E-37 1.4E-41  253.5   3.2   98    2-99     95-194 (196)
  2 PF10218 DUF2054:  Uncharacteri 100.0 1.6E-36 3.5E-41  243.5   4.9   86    2-87     43-131 (131)
  3 PF15024 Glyco_transf_18:  Glyc 100.0   3E-34 6.5E-39  273.1   8.0  118   68-203   441-559 (559)
  4 cd02340 ZZ_NBR1_like Zinc fing  12.1 1.3E+02  0.0029   19.5   1.3   22    5-33     12-33  (43)
  5 PF00187 Chitin_bind_1:  Chitin  12.0      65  0.0014   21.1  -0.3   16   12-28     12-27  (40)
  6 PF08120 Toxin_32:  Tamulustoxi  11.7      38 0.00083   21.3  -1.4   15   58-72      3-17  (35)
  7 cd02249 ZZ Zinc finger, ZZ typ  11.5 1.5E+02  0.0033   19.1   1.3   21    6-33     13-33  (46)
  8 cd02335 ZZ_ADA2 Zinc finger, Z  10.6 1.5E+02  0.0032   19.6   1.1   20    5-31     13-32  (49)
  9 PF13465 zf-H2C2_2:  Zinc-finge  10.2 1.7E+02  0.0036   16.7   1.1   12    4-15     11-22  (26)
 10 smart00270 ChtBD1 Chitin bindi   8.8 2.1E+02  0.0045   18.6   1.2   16   12-28     10-25  (38)

No 1  
>KOG3136 consensus Uncharacterized conserved protein [Function unknown]
Probab=100.00  E-value=6.4e-37  Score=253.53  Aligned_cols=98  Identities=58%  Similarity=1.072  Sum_probs=92.2

Q ss_pred             CCCcceeecCCCCCCCCCcccCccccccccCCCcc-HHHHHHhhhccCCcccccccchhHHHHhhhccCchhhhhhhhcc
Q 028769            2 LPRERREILLGCNLLSQCCNSYEYCVSCCVNPART-LKEQVLNVKIAKPTTAGTYGSVFDFCAGRCRHNSESVVHENAYL   80 (204)
Q Consensus         2 ~~~~~r~sC~~C~~~~~CC~~YE~CVSCCl~p~~~-~~e~~l~~~~~~~~~~~~~~d~Fe~C~~~CRT~s~sv~heN~Y~   80 (204)
                      +|+++||+|+|||..++||++|||||||||+|.|+ +||+||+++.+++.++++++||||||++||||+|+||+|||+|+
T Consensus        95 ~p~~~~ysC~gCn~~s~CC~~YEyCVSCCL~P~kQ~LLErvl~a~va~~~~f~tv~dhFelCl~kCRtnS~SV~HEN~Yr  174 (196)
T KOG3136|consen   95 GPSTKRYSCHGCNILSQCCNSYEYCVSCCLNPSKQTLLERVLKAKVAKPATFGTVKDHFELCLGKCRTNSESVVHENAYR  174 (196)
T ss_pred             CCCcceeecCCCccccchhhHHHHHHHHHcCCchhHHHHHHHhcccccchhhhhHHHHHHHHHHHhcCCchhheeccccc
Confidence            68999999999999899999999999999999985 56999999999999999999999999999999999999999999


Q ss_pred             cc-cCcccCCCCCCCCCCcc
Q 028769           81 SD-FHHCFSMPSNASGAGVT   99 (204)
Q Consensus        81 ~~-~~~C~~~~~~~~g~~~~   99 (204)
                      |+ .|||||.+.|.+|++..
T Consensus       175 dp~akhCyglt~~eS~~~l~  194 (196)
T KOG3136|consen  175 DPEAKHCYGLTSNESGANLT  194 (196)
T ss_pred             ChHHHhhcccccccCccccC
Confidence            97 69999999887787743


No 2  
>PF10218 DUF2054:  Uncharacterized conserved protein (DUF2054);  InterPro: IPR019352 This family of proteins includes those belonging to UPF0454. It is conserved from nematodes to plants and is functionally uncharacterised. It contains 14 conserved cysteines, three of which are CC-dimers. 
Probab=100.00  E-value=1.6e-36  Score=243.49  Aligned_cols=86  Identities=44%  Similarity=0.936  Sum_probs=81.3

Q ss_pred             CCCcceeecCCCCCCCCCcccCccccccccCCCcc-HHHHHH-hhhccCCcccccccchhHHHHhhhccCchhhhhhhhc
Q 028769            2 LPRERREILLGCNLLSQCCNSYEYCVSCCVNPART-LKEQVL-NVKIAKPTTAGTYGSVFDFCAGRCRHNSESVVHENAY   79 (204)
Q Consensus         2 ~~~~~r~sC~~C~~~~~CC~~YE~CVSCCl~p~~~-~~e~~l-~~~~~~~~~~~~~~d~Fe~C~~~CRT~s~sv~heN~Y   79 (204)
                      +|+++||+|++||+.++||++|||||||||+|+|+ +||+|| +++.+++.++++++|+||||++||||+|+||+|||+|
T Consensus        43 ~~~~~r~sC~~Cn~~~~CC~~YE~CVSCCL~P~k~~~le~~l~~~~~~~~~~~~~~~d~FelC~~kCRTsS~SV~HEN~Y  122 (131)
T PF10218_consen   43 APGTKRYSCDGCNLSSGCCSIYEYCVSCCLHPDKQPLLERVLRKAAVARQRLFGSVTDQFELCLAKCRTSSQSVQHENTY  122 (131)
T ss_pred             CCCceeEECCCcCCCCCcccchhhhhhhccChhhhhHHHHHHHHhhhcccceehhhccHHHHHHHHhcCCchhceecccc
Confidence            57899999999999999999999999999999975 578898 8889999999999999999999999999999999999


Q ss_pred             cc-ccCccc
Q 028769           80 LS-DFHHCF   87 (204)
Q Consensus        80 ~~-~~~~C~   87 (204)
                      ++ +.||||
T Consensus       123 r~p~~k~Cy  131 (131)
T PF10218_consen  123 RDPDAKHCY  131 (131)
T ss_pred             cCcccccCC
Confidence            99 589998


No 3  
>PF15024 Glyco_transf_18:  Glycosyltransferase family 18
Probab=100.00  E-value=3e-34  Score=273.15  Aligned_cols=118  Identities=30%  Similarity=0.579  Sum_probs=107.7

Q ss_pred             cCchhhhhhhhcccccCcccCCCCCCCCCCcccccccccceEEEeCCCCCcHHHHHHhcCCceecCCCcccccHHHHHhh
Q 028769           68 HNSESVVHENAYLSDFHHCFSMPSNASGAGVTQLEGRLSGISVIIGRQGESCDSVCKSSGQSCVLNKLILLNQCEIIQKY  147 (204)
Q Consensus        68 T~s~sv~heN~Y~~~~~~C~~~~~~~~g~~~~~~~ppl~~l~vv~~~~GqSC~~~C~~~gl~CepsfF~~iN~c~~l~k~  147 (204)
                      |.+|||+|+|+|+++|+||.+..          .|||+++|+||++++||||+++|+++||+|||+||++||++++|+|+
T Consensus       441 T~egmLeRv~~~ie~q~fC~~~~----------~WPPlsaL~vv~~~~GqSC~~~C~~~gliCEPsfFp~IN~~~~l~r~  510 (559)
T PF15024_consen  441 TCEGMLERVNALIEKQDFCDKSV----------RWPPLSALQVVLGEPGQSCKDACQSKGLICEPSFFPFINRCDELQRL  510 (559)
T ss_pred             CHHHHHHHHHHHHHhhhhccccC----------CCCChhheEEEEcCCCCCHHHHHHhhCcEEcHhhhhhhccHHHHHhh
Confidence            89999999999999999999985          48999999999999999999999999999999999999999999997


Q ss_pred             -CCccccccccCCCCCCcccccCCCCCCCCCceeecCCCCccccCCCCCCCceeccC
Q 028769          148 -MSCKRGCLASMGADQPAEVADDAPSNLNPTACLYTRIQSMLSCDGSHRHTRRLCPC  203 (204)
Q Consensus       148 -~~C~~~c~~~~g~~~Pa~v~~~ap~~~~~~~C~lq~~~llFSCags~~~~rRLCPC  203 (204)
                       ++|++. +...++.+|++       +.++++|++|++++||||+|+++++||||||
T Consensus       511 ~~~C~~~-e~~~~~~aP~f-------~~~~~~C~lQ~~~lLFSCags~~~~rRLCPC  559 (559)
T PF15024_consen  511 GVNCDST-ESEMSHLAPAF-------SPNPGHCVLQSDPLLFSCAGSHPSYRRLCPC  559 (559)
T ss_pred             CCCCCcc-cccCcccCCCC-------CCCCCeeeeCCCCceeecCCCCCCCCccCCC
Confidence             689963 44445666665       3567899999999999999999999999999


No 4  
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=12.10  E-value=1.3e+02  Score=19.47  Aligned_cols=22  Identities=32%  Similarity=0.569  Sum_probs=16.7

Q ss_pred             cceeecCCCCCCCCCcccCccccccccCC
Q 028769            5 ERREILLGCNLLSQCCNSYEYCVSCCVNP   33 (204)
Q Consensus         5 ~~r~sC~~C~~~~~CC~~YE~CVSCCl~p   33 (204)
                      ..||.|..|.       .|..|.+|=..+
T Consensus        12 G~ry~C~~C~-------d~dLC~~C~~~~   33 (43)
T cd02340          12 GVRYKCLVCP-------DYDLCESCEAKG   33 (43)
T ss_pred             CCeEECCCCC-------CccchHHhhCcC
Confidence            4689999884       588888886554


No 5  
>PF00187 Chitin_bind_1:  Chitin recognition protein;  InterPro: IPR001002 A number of plant and fungal proteins that bind N-acetylglucosamine (e.g. solanaceous lectins of tomato and potato, plant endochitinases, the wound-induced proteins: hevein, win1 and win2, and the Kluyveromyces lactis killer toxin alpha subunit) contain this domain []. The domain may occur in one or more copies and is thought to be involved in recognition or binding of chitin subunits [, ]. In chitinases, as well as in the potato wound-induced proteins, the 43-residue domain directly follows the signal sequence and is therefore at the N terminus of the mature protein; in the killer toxin alpha subunit it is located in the central section of the protein. ; GO: 0008061 chitin binding; PDB: 9WGA_B 2WGC_B 1ULK_B 2UVO_B 1WGC_B 2CWG_A 2X3T_C 4AML_B 7WGA_B 1ZWU_A ....
Probab=11.99  E-value=65  Score=21.10  Aligned_cols=16  Identities=38%  Similarity=1.121  Sum_probs=11.3

Q ss_pred             CCCCCCCCcccCccccc
Q 028769           12 GCNLLSQCCNSYEYCVS   28 (204)
Q Consensus        12 ~C~~~~~CC~~YE~CVS   28 (204)
                      .|.. +.|||.|-||-.
T Consensus        12 ~Cp~-~~CCS~~G~CG~   27 (40)
T PF00187_consen   12 TCPN-GLCCSQYGYCGT   27 (40)
T ss_dssp             BSGG-G-EEETTSBEES
T ss_pred             cCCC-CCccCCCCcccC
Confidence            4643 789999999854


No 6  
>PF08120 Toxin_32:  Tamulustoxin family;  InterPro: IPR012636 This family consists of the tamulustoxins, which are found in the venom of Mesobuthus tamulus (Eastern Indian scorpion) (Buthus tamulus). Tamulustoxin shares no similarity with other scorpion venom toxins, although the positions of its six cysteine residues suggest that it shares the same structural scaffold. Tamulustoxin acts as a potassium channel blocker [].; GO: 0019870 potassium channel inhibitor activity, 0009405 pathogenesis, 0005576 extracellular region
Probab=11.73  E-value=38  Score=21.34  Aligned_cols=15  Identities=40%  Similarity=0.811  Sum_probs=11.2

Q ss_pred             hhHHHHhhhccCchh
Q 028769           58 VFDFCAGRCRHNSES   72 (204)
Q Consensus        58 ~Fe~C~~~CRT~s~s   72 (204)
                      ||-.|...||-+|--
T Consensus         3 hfvicttdcrrnspg   17 (35)
T PF08120_consen    3 HFVICTTDCRRNSPG   17 (35)
T ss_pred             eEEEeccccccCCCC
Confidence            677888888877643


No 7  
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=11.48  E-value=1.5e+02  Score=19.13  Aligned_cols=21  Identities=29%  Similarity=0.646  Sum_probs=15.3

Q ss_pred             ceeecCCCCCCCCCcccCccccccccCC
Q 028769            6 RREILLGCNLLSQCCNSYEYCVSCCVNP   33 (204)
Q Consensus         6 ~r~sC~~C~~~~~CC~~YE~CVSCCl~p   33 (204)
                      .||.|..|.       .|..|.+|=..+
T Consensus        13 ~r~~C~~C~-------d~dLC~~Cf~~~   33 (46)
T cd02249          13 VRYHCLVCE-------DFDLCSSCYAKG   33 (46)
T ss_pred             CEEECCCCC-------CCcCHHHHHCcC
Confidence            788888884       588888775444


No 8  
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=10.62  E-value=1.5e+02  Score=19.55  Aligned_cols=20  Identities=20%  Similarity=0.600  Sum_probs=12.9

Q ss_pred             cceeecCCCCCCCCCcccCcccccccc
Q 028769            5 ERREILLGCNLLSQCCNSYEYCVSCCV   31 (204)
Q Consensus         5 ~~r~sC~~C~~~~~CC~~YE~CVSCCl   31 (204)
                      ..||.|..|.       .|..|.+|=.
T Consensus        13 g~r~~C~~C~-------d~dLC~~Cf~   32 (49)
T cd02335          13 TIRIKCAECP-------DFDLCLECFS   32 (49)
T ss_pred             CcEEECCCCC-------CcchhHHhhh
Confidence            3677777773       3777777643


No 9  
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=10.15  E-value=1.7e+02  Score=16.69  Aligned_cols=12  Identities=17%  Similarity=0.047  Sum_probs=9.7

Q ss_pred             CcceeecCCCCC
Q 028769            4 RERREILLGCNL   15 (204)
Q Consensus         4 ~~~r~sC~~C~~   15 (204)
                      +.++|.|+-|+.
T Consensus        11 ~~k~~~C~~C~k   22 (26)
T PF13465_consen   11 GEKPYKCPYCGK   22 (26)
T ss_dssp             SSSSEEESSSSE
T ss_pred             CCCCCCCCCCcC
Confidence            568899999964


No 10 
>smart00270 ChtBD1 Chitin binding domain.
Probab=8.78  E-value=2.1e+02  Score=18.55  Aligned_cols=16  Identities=38%  Similarity=1.045  Sum_probs=11.8

Q ss_pred             CCCCCCCCcccCccccc
Q 028769           12 GCNLLSQCCNSYEYCVS   28 (204)
Q Consensus        12 ~C~~~~~CC~~YE~CVS   28 (204)
                      .|.. ..||+.|.||-.
T Consensus        10 ~C~~-~~CCS~~G~CG~   25 (38)
T smart00270       10 VCPN-NLCCSQFGYCGS   25 (38)
T ss_pred             cCCC-CCccCCCcCccC
Confidence            5643 689999988843


Done!