Citrus Sinensis ID: 028781


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MDRSDAQSPQVETARILAEFLEVAITSVVFLKGLYPSGAFERRRYMNLVVQRARHPQLRDYIHSSVSSLLLFIQKGLVERVAVIFSNANNVPLERYVFKIMVNQSYGSMVEEGHLEFSLRSFLIKLSVSKSLSKVLPQGCRWEITAYFCSLPQVNTSKDAELWIPTDTKQWQQPPLITPIKSMSSDSLSVQLYLENPSLLEENL
cccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHEEccccEEEECccHHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEEECcccccccccccccccccccccccccccEEEEEEEECccEEEEEEEEccccccccc
*************ARILAEFLEVAITSVVFLKGLYPSGAFERRRYMNLVVQRARHPQLRDYIHSSVSSLLLFIQKGLVERVAVIFSNANNVPLERYVFKIMVNQSYGSMVEEGHLEFSLRSFLIKLSVSKSLSKVLPQGCRWEITAYFCSLPQVNTSKDAELWIPTDTKQWQQ**L*T*IKSMSSDSLSVQLYLENPSL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRSDAQSPQVETARILAEFLEVAITSVVFLKGLYPSGAFERRRYMNLVVQRARHPQLRDYIHSSVSSLLLFIQKGLVERVAVIFSNANNVPLERYVFKIMVNQSYGSMVEEGHLEFSLRSFLIKLSVSKSLSKVLPQGCRWEITAYFCSLPQVNTSKDAELWIPTDTKQWQQPPLITPIKSMSSDSLSVQLYLENPSLLEENL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitotic spindle assembly checkpoint protein MAD2B Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit REV3L and the inserter polymerase REV1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. May also play a role in signal transduction in response to DNA damage. May regulate the activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Through transcriptional regulation may play a role in epithelial-mesenchymal transdifferentiation.probableQ4KWZ6
Mitotic spindle assembly checkpoint protein MAD2B Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit rev3l and the inserter polymerase rev1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. May also play a role in signal transduction in response to DNA damage. May regulate the activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Through transcriptional regulation may play a role in epithelial-mesenchymal transdifferentiation.probableQ568H3
Mitotic spindle assembly checkpoint protein MAD2B Adapter protein able to interact with different proteins and involved in different biological processes. Mediates the interaction between the error-prone DNA polymerase zeta catalytic subunit rev3l and the inserter polymerase rev1, thereby mediating the second polymerase switching in translesion DNA synthesis. Translesion DNA synthesis releases the replication blockade of replicative polymerases, stalled in presence of DNA lesions. May also play a role in signal transduction in response to DNA damage. May regulate the activation of the anaphase promoting complex APC thereby regulating progression through the cell cycle. Through transcriptional regulation may play a role in epithelial-mesenchymal transdifferentiation.probableQ28H85

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FJO, chain C
Confidence level:confident
Coverage over the Query: 1-195
View the alignment between query and template
View the model in PyMOL