Citrus Sinensis ID: 028796

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MSLFWIVIRQLAEIEAMAMSKKVITREEWEKKLNDVKIRKEDMNKLVMNFLVTEGYVDAAEKFRMESGTEPDIDLATITDRMAVKKAVQCGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEENQSFLEELERTVALLAFEDVSNCPVGDLLDISQRLKTASEVNAAILTSQSHEKG
cHHHHHHHHHHHHHHHHHHcHHHccHHHHHHHHccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHHHHHHHHHHHHcccccc
**LFWIVIRQLAEIEAMAMSKKVITREEWEKKLNDVKIRKEDMNKLVMNFLVTEGYVDAAEKFRMESGTEPDIDLATITDRMAVKKAVQCGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEENQSFLEELERTVALLAFEDVSNCPVGDLLDISQRLKTASEVNAAI**SQ*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLFWIVIRQLAEIEAMAMSKKVITxxxxxxxxxxxxxxxxxxxxxVMNFLVTEGYVDAAEKFRMESGTEPDIDLATITDRMAVKKAVQCGNVEDAIEKVNDLNPEILDTNPQLFFHLQQQRLIELIRNGKVEEALEFAQEELAPRGEENQSFLEELERTVALLAFEDVSNCPVGDLLDISQRLKTASEVNAAILTSQSHEKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glucose-induced degradation protein 8 homolog probableQ6PC55
Glucose-induced degradation protein 8 homolog probableQ9D7M1
Glucose-induced degradation protein 8 homolog probableQ5ZKQ7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XTC, chain A
Confidence level:probable
Coverage over the Query: 37-70
View the alignment between query and template
View the model in PyMOL
Template: 2NXP, chain A
Confidence level:probable
Coverage over the Query: 96-168
View the alignment between query and template
View the model in PyMOL