BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028809
(203 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1HH7|A Chain A, Refined Crystal Structure Of Cytochrome C2 From
Rhodopseudomonas Palustris At 1.4 Angstrom Resolution
pdb|1I8O|A Chain A, Rhodopseudomonas Palustris Cyt C2 Ammonia Complex At 1.15
Angstrom Resolution
pdb|1I8P|A Chain A, Structure Determination Of The Ferrocytochrome C2 From
Rhodopseudomonas Palustris
pdb|1I8P|B Chain B, Structure Determination Of The Ferrocytochrome C2 From
Rhodopseudomonas Palustris
pdb|1I8P|C Chain C, Structure Determination Of The Ferrocytochrome C2 From
Rhodopseudomonas Palustris
pdb|1I8P|D Chain D, Structure Determination Of The Ferrocytochrome C2 From
Rhodopseudomonas Palustris
pdb|1FJ0|A Chain A, Structure Determination Of The Ferricytochrome C2 From
Rhodopseudomonas Palustris
pdb|1FJ0|B Chain B, Structure Determination Of The Ferricytochrome C2 From
Rhodopseudomonas Palustris
pdb|1FJ0|C Chain C, Structure Determination Of The Ferricytochrome C2 From
Rhodopseudomonas Palustris
pdb|1FJ0|D Chain D, Structure Determination Of The Ferricytochrome C2 From
Rhodopseudomonas Palustris
Length = 114
Score = 27.7 bits (60), Expect = 4.6, Method: Compositional matrix adjust.
Identities = 13/33 (39%), Positives = 20/33 (60%)
Query: 166 KIFKTDQIKAEMKNGVLKLTLPMMKEDERTDVL 198
K F T++ KA+ GV K+T + E +R DV+
Sbjct: 75 KKFLTEKGKADQAVGVTKMTFKLANEQQRKDVV 107
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.128 0.354
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,954,473
Number of Sequences: 62578
Number of extensions: 108658
Number of successful extensions: 202
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 195
Number of HSP's gapped (non-prelim): 4
length of query: 203
length of database: 14,973,337
effective HSP length: 94
effective length of query: 109
effective length of database: 9,091,005
effective search space: 990919545
effective search space used: 990919545
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)