Citrus Sinensis ID: 028812

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MRSILLRIFLLYTFILHLLPKKLRRFLPRSWFPAPALGPSLSSQSNTNPTRSTMDQAELDRVFQMFDHNGDGRISKKELNDSLENLGIYIPDVELTQMIERIDVNGDGCVDIDEFGALYKSIMEEKDEEEDMKEAFNVFDQNGDGFITFDELKSVLGSLGLKQGRTVEDCKRMIMKVDVDGDGMVDYKEFKQMMKGGGFSALT
ccHHHHHHHHHHHHHHcccHHHHHHHccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHccccccCEcHHHHHHHHHHHHcccccHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccHHHHHHHHHcccccccccccHHHHHHHHHcccccccc
*RSILLRIFLLYTFILHLLPKKLRRFLPRSWFPA*************************DRVFQMFDHNGDGRISKKELNDSLENLGIYIPDVELTQMIERIDVNGDGCVDIDEFGALYKSIM**********EAFNVFDQNGDGFITFDELKSVLGSLGLKQGRTVEDCKRMIMKVDVDGDGMVDYKEFKQMMKGGG*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSILLRIFLLYTFILHLLPKKLRRFLPRSWFPAPALGPSLSSQSNTNPTRSTMDQAELDRVFQMFDHNGDGRISKKELNDSLENLGIYIPDVELTQMIERIDVNGDGCVDIDEFGALYKSIMEEKDEEEDMKEAFNVFDQNGDGFITFDELKSVLGSLGLKQGRTVEDCKRMIMKVDVDGDGMVDYKEFKQMMKGGGFSALT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calmodulin-like protein 5 Potential calcium sensor.probableO22845
Probable calcium-binding protein CML28 Potential calcium sensor.probableQ2QVI1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2F2O, chain A
Confidence level:very confident
Coverage over the Query: 52-196
View the alignment between query and template
View the model in PyMOL
Template: 3SOA, chain A
Confidence level:probable
Coverage over the Query: 15-79,92-197
View the alignment between query and template
View the model in PyMOL