Citrus Sinensis ID: 028816


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MANQAATAFSGNMKKALAGLRRINLEGLRWRVFDAKGQVLGRLASQVATVVQGKDKPTYAPNRDDGDMCIVLNAKDICVTGRKLKNKVYYWHTGYIGHLKERTLKEQMERDPTEAIRKAVLRMLPRNKLRDDRDRKLRIFPGSEHPFGDRPLEPYVMPPRRVRELRPRVRRAMIREQKKAEMQQSNKDMRKNRKKEVEAEVTA
cccccccccccccccEEccccccccccccEEEEEcccccHHHHHHHHHHHHccccccccccccccccEEEEEEcccEEEEcccccccEEEEccccccccccccHHHHHHcccHHHHHHHHHccccccccHHHHHHcccccccccccccccccccECccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
************MKKALAGLRRINLEGLRWRVFDAKGQVLGRLASQVATVVQGKDKPTYAPNRDDGDMCIVLNAKDICVTGRKLKNKVYYWHTGYIGHLKERTLKEQMERDPTEAIRKAVLRMLPRNKLRDDRDRKLRIFPGSEHPFGDRPLEPYVMPP********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MANQAATAFSGNMKKALAGLRRINLEGLRWRVFDAKGQVLGRLASQVATVVQGKDKPTYAPNRDDGDMCIVLNAKDICVTGRKLKNKVYYWHTGYIGHLKERTLKEQMERDPTEAIRKAVLRMLPRNKLRDDRDRKLRIFPGSEHPFGDRPLEPYVMPPRRVRELRPRVRRAMIxxxxxxxxxxxxxxxxxxxxxEVEAEVTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L13 This protein is one of the early assembly proteins of the 50S ribosomal subunit, although it is not seen to bind rRNA by itself. It is important during the early stages of 50S assembly.probableO67722

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FTC, chain H
Confidence level:very confident
Coverage over the Query: 23-158
View the alignment between query and template
View the model in PyMOL
Template: 4A17, chain I
Confidence level:very confident
Coverage over the Query: 28-52,65-180
View the alignment between query and template
View the model in PyMOL