Citrus Sinensis ID: 028839

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---

MGELKYELSQNAYIKLVLHARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPKGKDRSPVMQLYIRDASKNWKLVGSDGGCQLLTKEPAANVVLMDYISSEKWQDVVDFDDHLDDISKDWLNPDLFK

cccEEEEEcHHHHHHHHHHHHccccccccEEEEEECccccccEEEEEEcCEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEECccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEEcccccEEEcccccccccccccccHHHHHHHHHHcccccccccccccccccccccccccccc

****KYELSQNAYIKLVLHARKHKTAAVNGVLLGRVSPQNDAVVEIADSVPLFHSHLGLLPNLEISLIMIEEHYSAQGLGIVGYFHANERFDDLELDSIAKNIGNHICRYFPQCAVLLLDNKKLEALPKGKDRSPVMQLYIRDASKNWKLVGSDGGCQLLTKEPAANVVLMDYISSEKWQDVVDFDDHLDDISKDWLNPDLF*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
ER membrane protein complex subunit 8/9 homolog		confident	Q9FG71
ER membrane protein complex subunit 9		probable	Q5U1W7
ER membrane protein complex subunit 9		probable	Q9Y3B6

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4B4T, chain V
Confidence level:confident
Coverage over the Query: 6-142
View the alignment between query and template
View the model in PyMOL