Citrus Sinensis ID: 028864


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSCSINKTIERYQKKTKDIGINSKIVEDHSQHAKEETSNMMTKLEFLEVAKRKLLGDGLEPCTIDELQQLENQLERSLSRIRARKNQLFREQIEKLKEKEKILIEENTKLREQCGMQPRQASEEQEVYMDVETQLSIGPPERRVA
cccccccHHHccccccccccccccccccHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccccc
*****TQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSCSINKTIERYQKKTKDIGIN***********KEETSNMMTKLEFLEVAKRKLLGDGLEPCTIDELQQLENQLERSLSRIRARKNQLFREQIEKLKEKEKILIEENTKL****************************PP*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVRGKTQMKRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIIFSPRGKLYEFSSCSINKTIERYQKKTKDIGINSKIVEDHSQHAKEETSNMMTKLEFLEVAKRKLLGDGLEPCTxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxCGMQPRQASEEQEVYMDVETQLSIGPPERRVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Agamous-like MADS-box protein AGL19 Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner.probableO82743
MADS-box transcription factor 50 Probable transcription factor active in flowering time control. May control internode elongation and promote floral transition phase. May act upstream of the floral regulators MADS1, MADS14, MADS15 and MADS18 in the floral induction pathway.probableQ9XJ60
MADS-box transcription factor 56 Probable transcription factor.probableA2Z9Q7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EGW, chain A
Confidence level:very confident
Coverage over the Query: 2-72
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 119-166
View the alignment between query and template
View the model in PyMOL