Query         028876
Match_columns 202
No_of_seqs    17 out of 19
Neff          2.3 
Searched_HMMs 46136
Date          Fri Mar 29 03:56:41 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028876.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028876hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF06633 DUF1155:  Protein of u  48.5     7.9 0.00017   26.8   0.6   18   17-34      6-23  (42)
  2 PF10071 DUF2310:  Zn-ribbon-co  27.1      48   0.001   29.9   2.3   32   24-63    130-161 (258)
  3 PF03835 Rad4:  Rad4 transgluta  18.3      35 0.00076   26.7  -0.3   83   19-111    49-144 (145)
  4 PF13630 SdpI:  SdpI/YhfL prote  17.7      77  0.0017   21.6   1.3   17   46-62     16-32  (76)
  5 PF13723 Ketoacyl-synt_2:  Beta  15.3 1.7E+02  0.0036   25.4   3.0   35   14-48    132-166 (218)
  6 PF11001 DUF2841:  Protein of u  14.8      65  0.0014   26.2   0.4   26   77-102    45-71  (126)
  7 KOG2262 Sexual differentiation  14.7      73  0.0016   33.0   0.8   24   23-48     50-74  (761)
  8 PF10347 Fmp27_GFWDK:  RNA pol   13.6 1.3E+02  0.0028   24.9   1.9   23   23-46      1-29  (154)
  9 PF14766 RPA_interact_N:  Repli  12.0 1.6E+02  0.0034   19.7   1.6   20   81-109     6-26  (42)
 10 PF15411 PH_10:  Pleckstrin hom  11.8 2.6E+02  0.0055   22.0   2.9   24   35-59     91-114 (116)

No 1  
>PF06633 DUF1155:  Protein of unknown function (DUF1155);  InterPro: IPR009536 This family consists of several Cucumber mosaic virus ORF IIB proteins. The function of this family is unknown.
Probab=48.48  E-value=7.9  Score=26.76  Aligned_cols=18  Identities=39%  Similarity=0.713  Sum_probs=16.0

Q ss_pred             ceeeeccCCCcccccCCC
Q 028876           17 STVIKFDKPIPLLRGPVP   34 (202)
Q Consensus        17 at~i~FD~plPLlR~PvP   34 (202)
                      .|+..|+|||-||--|-|
T Consensus         6 st~~sfepplslla~pg~   23 (42)
T PF06633_consen    6 STTLSFEPPLSLLAEPGT   23 (42)
T ss_pred             cceeccCCchHHHcCCCc
Confidence            578999999999998876


No 2  
>PF10071 DUF2310:  Zn-ribbon-containing, possibly nucleic-acid-binding protein (DUF2310);  InterPro: IPR016908 This group represents uncharacterised conserved proteins.
Probab=27.10  E-value=48  Score=29.95  Aligned_cols=32  Identities=25%  Similarity=0.727  Sum_probs=22.0

Q ss_pred             CCCcccccCCCCCCCCCCCceeeecChhhHHHHHHHHhHh
Q 028876           24 KPIPLLRGPVPHDDPSSGSYLLAFRSHQSWASAYESCESK   63 (202)
Q Consensus        24 ~plPLlR~PvP~ddpS~gp~vLAFrd~~SW~~a~~~cE~~   63 (202)
                      .||||.|.|-..+..        +.+-=+|...|++|-.-
T Consensus       130 ~pIPLY~lp~~~~~~--------~~~iikWQ~~wqAcD~L  161 (258)
T PF10071_consen  130 QPIPLYRLPKTANGD--------YKAIIKWQEDWQACDQL  161 (258)
T ss_pred             CcccCeecCCCCCcc--------hHHHHHHHHHHHHHHHH
Confidence            378999988332221        34566999999999753


No 3  
>PF03835 Rad4:  Rad4 transglutaminase-like domain;  InterPro: IPR018325 RAD4/Xp-C proteins contain an ancient transglutaminase fold that is also found in peptide-N-glycanases (PNGases), which remove glycans from glycoproteins during their degradation. The PNGases retain the catalytic triad that is typical of this fold and are predicted to have a reaction mechanism similar to that involved in transglutamination. In contrast, the RAD4/Xp-C proteins are predicted to be inactive and are likely to only possess the interaction function in DNA repair []. ; GO: 0003684 damaged DNA binding, 0006289 nucleotide-excision repair, 0005634 nucleus; PDB: 2QSG_A 2QSF_A 2QSH_A 1X3W_A 1X3Z_A 3ESW_A.
Probab=18.32  E-value=35  Score=26.71  Aligned_cols=83  Identities=20%  Similarity=0.307  Sum_probs=37.6

Q ss_pred             eeeccCCCc---ccccCCC--CCCCCCCCceeeecChh-----hHHHHHHHHhHhHHHHhhhcccccccccccccCCChh
Q 028876           19 VIKFDKPIP---LLRGPVP--HDDPSSGSYLLAFRSHQ-----SWASAYESCESKVLSQCEHGARIGCSVNASKKCKPPW   88 (202)
Q Consensus        19 ~i~FD~plP---LlR~PvP--~ddpS~gp~vLAFrd~~-----SW~~a~~~cE~~i~sQCEaGAr~GCSIsASrkCkpPW   88 (202)
                      -|..||..-   ....+-|  ......-.||+||-+..     +.|=+......+     ....|+.     ...+...|
T Consensus        49 WI~VDp~~~~~~~~~~~ep~~~~~~~~~~YViA~d~~~~~kDVT~RY~~~~~~~~-----~~r~R~~-----~~~~~~~W  118 (145)
T PF03835_consen   49 WIHVDPVVGKIIKVSCDEPLEENANNPMSYVIAFDNDGYAKDVTRRYASNYWNSK-----TRRLRVD-----RSYEEEDW  118 (145)
T ss_dssp             EEEEETTTS-EESTBTTSTCCCCCS--B-EEEEE-CTTEEEE-HHHH-T-TCCCC-----CGGGSGG-----GSHHHHHH
T ss_pred             EEEeeeeccccccccccCchhhccCCceEEEEEEeCCCCEEEchHhhcccccccc-----cccccCC-----ccccHHHH
Confidence            344555443   2344444  33445578999993322     333332212111     1233443     55566889


Q ss_pred             hhhhcCCCCC---ChhHHHHHHHHHH
Q 028876           89 WRNLIGQRPA---DFKEREDCEVREM  111 (202)
Q Consensus        89 Wk~l~g~~~~---d~~eRE~CEeREM  111 (202)
                      |+.++.....   +..+|+.=|.+||
T Consensus       119 ~~~~l~~~~~~~~~~~~~d~~Ed~el  144 (145)
T PF03835_consen  119 WEKVLRPYNRPRRDRTIRDKKEDEEL  144 (145)
T ss_dssp             HHHHHHHH--S---H--HHHHHHHHH
T ss_pred             HHHHHHHHhcccccccchHHHHHhhc
Confidence            9999853222   2223566677776


No 4  
>PF13630 SdpI:  SdpI/YhfL protein family
Probab=17.70  E-value=77  Score=21.56  Aligned_cols=17  Identities=18%  Similarity=0.425  Sum_probs=13.8

Q ss_pred             eecChhhHHHHHHHHhH
Q 028876           46 AFRSHQSWASAYESCES   62 (202)
Q Consensus        46 AFrd~~SW~~a~~~cE~   62 (202)
                      +.+|++.|+.|++.+-.
T Consensus        16 t~~s~~~W~~a~r~~g~   32 (76)
T PF13630_consen   16 TMKSDENWKKAHRFAGK   32 (76)
T ss_pred             HhCCHHHHHHHHHHHHH
Confidence            46789999999998753


No 5  
>PF13723 Ketoacyl-synt_2:  Beta-ketoacyl synthase, N-terminal domain
Probab=15.31  E-value=1.7e+02  Score=25.38  Aligned_cols=35  Identities=17%  Similarity=0.293  Sum_probs=26.9

Q ss_pred             CccceeeeccCCCcccccCCCCCCCCCCCceeeec
Q 028876           14 SAASTVIKFDKPIPLLRGPVPHDDPSSGSYLLAFR   48 (202)
Q Consensus        14 S~sat~i~FD~plPLlR~PvP~ddpS~gp~vLAFr   48 (202)
                      ...+.||.||-|+|-.-.++..+..-..||.||+.
T Consensus       132 ~~~VLlv~~De~~p~~y~~~~~~~~~~~~~A~al~  166 (218)
T PF13723_consen  132 AEPVLLVCYDEPLPEPYQEFRPERDPPFPYALALV  166 (218)
T ss_pred             CCCEEEEEeCCCCChhhhhcccccCCCcCEEEEEE
Confidence            56789999999999888877654445567877764


No 6  
>PF11001 DUF2841:  Protein of unknown function (DUF2841);  InterPro: IPR021264  This family of proteins with unknown function are all present in yeast. 
Probab=14.78  E-value=65  Score=26.20  Aligned_cols=26  Identities=35%  Similarity=0.868  Sum_probs=17.0

Q ss_pred             cccccccCCChhhhhhc-CCCCCChhH
Q 028876           77 SVNASKKCKPPWWRNLI-GQRPADFKE  102 (202)
Q Consensus        77 SIsASrkCkpPWWk~l~-g~~~~d~~e  102 (202)
                      ..+-.++.|||||=.-+ -.-|+-+.+
T Consensus        45 PY~~g~~tkP~WWP~~V~HkEPDHL~K   71 (126)
T PF11001_consen   45 PYNGGDKTKPPWWPEDVRHKEPDHLKK   71 (126)
T ss_pred             CCCCCCCCCCCCCCCCCCcCCCCccCH
Confidence            44455689999997655 345555554


No 7  
>KOG2262 consensus Sexual differentiation process protein ISP4 [Signal transduction mechanisms]
Probab=14.70  E-value=73  Score=33.00  Aligned_cols=24  Identities=50%  Similarity=0.897  Sum_probs=20.2

Q ss_pred             cCCCcccccCCC-CCCCCCCCceeeec
Q 028876           23 DKPIPLLRGPVP-HDDPSSGSYLLAFR   48 (202)
Q Consensus        23 D~plPLlR~PvP-~ddpS~gp~vLAFr   48 (202)
                      |.|+|=+|.-|| .|||+-  ||+-||
T Consensus        50 ~spv~EVrl~Vp~tDDptl--Pv~TfR   74 (761)
T KOG2262|consen   50 DSPVPEVRLTVPPTDDPTL--PVLTFR   74 (761)
T ss_pred             cCcchhheeecCCCCCCCc--hhHhHH
Confidence            489999999999 788875  688887


No 8  
>PF10347 Fmp27_GFWDK:  RNA pol II promoter Fmp27 protein domain;  InterPro: IPR019441 This domain is found in fungi, metazoans and plants that contains a characteristic GFWDK sequence motif. These include FMP27 and maize protein APT1 and Arabidopsis homologues SABRE and KIP. The function of the FMP27 protein is not known. FMP27 is the product of a nuclear encoded gene but it is detected in highly purified mitochondria in high-throughput studies []. APT1 is required for pollen tube growth. It is a Golgi-localised protein and appears to regulate vesicular trafficking []. SABRE and KIP are APT1 homologues and they are involved in the elongation of root cortex cells and pollen tubes respectively.
Probab=13.64  E-value=1.3e+02  Score=24.94  Aligned_cols=23  Identities=52%  Similarity=1.024  Sum_probs=15.0

Q ss_pred             cCCCcccccCCCCCCCC------CCCceee
Q 028876           23 DKPIPLLRGPVPHDDPS------SGSYLLA   46 (202)
Q Consensus        23 D~plPLlR~PvP~ddpS------~gp~vLA   46 (202)
                      |-|||||-+| ++.+++      .|.+|+|
T Consensus         1 DYPlPll~ip-~~~~~~~~~~~~~G~lVia   29 (154)
T PF10347_consen    1 DYPLPLLHIP-PNQDPSSPSWSLKGDLVIA   29 (154)
T ss_pred             CCCCCeEecc-cccCCCCccEEEEccEEEE
Confidence            6799999999 533333      2455665


No 9  
>PF14766 RPA_interact_N:  Replication protein A interacting N-terminal
Probab=12.02  E-value=1.6e+02  Score=19.75  Aligned_cols=20  Identities=40%  Similarity=0.694  Sum_probs=12.8

Q ss_pred             cccC-CChhhhhhcCCCCCChhHHHHHHHH
Q 028876           81 SKKC-KPPWWRNLIGQRPADFKEREDCEVR  109 (202)
Q Consensus        81 SrkC-kpPWWk~l~g~~~~d~~eRE~CEeR  109 (202)
                      +.|- ++|-||.-+         ||+|-+|
T Consensus         6 ~~k~~~~p~WKe~l---------R~rC~~R   26 (42)
T PF14766_consen    6 LYKQRKSPPWKETL---------RERCLER   26 (42)
T ss_pred             hhccCCCccHHHHH---------HHHHHHH
Confidence            3444 667777654         7888766


No 10 
>PF15411 PH_10:  Pleckstrin homology domain
Probab=11.80  E-value=2.6e+02  Score=21.97  Aligned_cols=24  Identities=25%  Similarity=0.547  Sum_probs=18.3

Q ss_pred             CCCCCCCCceeeecChhhHHHHHHH
Q 028876           35 HDDPSSGSYLLAFRSHQSWASAYES   59 (202)
Q Consensus        35 ~ddpS~gp~vLAFrd~~SW~~a~~~   59 (202)
                      .+|+..+-|+|-|||++.- ..|+.
T Consensus        91 ~~d~e~~~F~lrf~nee~l-~~W~~  114 (116)
T PF15411_consen   91 KGDPELENFTLRFRNEEQL-EQWRS  114 (116)
T ss_pred             cCCCCCceEEEEeCCHHHH-HHHHh
Confidence            4678899999999999873 34544


Done!