Citrus Sinensis ID: 028879
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| 297742337 | 1479 | unnamed protein product [Vitis vinifera] | 0.866 | 0.118 | 0.805 | 1e-81 | |
| 255537803 | 245 | conserved hypothetical protein [Ricinus | 0.920 | 0.759 | 0.796 | 2e-80 | |
| 359473918 | 521 | PREDICTED: uncharacterized protein LOC10 | 0.881 | 0.341 | 0.797 | 4e-80 | |
| 388509664 | 188 | unknown [Lotus japonicus] | 0.915 | 0.984 | 0.745 | 6e-77 | |
| 297803746 | 247 | hypothetical protein ARALYDRAFT_492476 [ | 0.915 | 0.748 | 0.764 | 6e-77 | |
| 42573011 | 247 | Pleckstrin homology (PH) domain-containi | 0.915 | 0.748 | 0.743 | 2e-75 | |
| 227204407 | 188 | AT4G23895 [Arabidopsis thaliana] | 0.915 | 0.984 | 0.743 | 5e-75 | |
| 334186865 | 467 | Pleckstrin homology (PH) domain-containi | 0.871 | 0.376 | 0.758 | 1e-74 | |
| 356539323 | 189 | PREDICTED: uncharacterized protein LOC10 | 0.925 | 0.989 | 0.739 | 1e-74 | |
| 449452212 | 252 | PREDICTED: uncharacterized protein LOC10 | 0.881 | 0.706 | 0.751 | 9e-72 |
| >gi|297742337|emb|CBI34486.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 307 bits (787), Expect = 1e-81, Method: Compositional matrix adjust.
Identities = 141/175 (80%), Positives = 159/175 (90%)
Query: 1 MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA 60
MLN+FSLRGLPW SSSD QEKVELT ELESLR+ELA LE+REAH KAQLEHVDEILRSA
Sbjct: 1291 MLNLFSLRGLPWGSSSDDQEKVELTVAELESLRTELASLEEREAHFKAQLEHVDEILRSA 1350
Query: 61 RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS 120
RLSGYLYIRTRW LPGEPPPIDDT+VDDWLPRF+VLHGSC+FFY+LSTDLSPQDST+LS
Sbjct: 1351 RLSGYLYIRTRWAALPGEPPPIDDTEVDDWLPRFVVLHGSCLFFYMLSTDLSPQDSTLLS 1410
Query: 121 DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKL 175
DV EV LP++TRE+ E++YCFYILT HGLR ECSS+SK+QV SWL+AL+ DCK+
Sbjct: 1411 DVTEVGPLPNLTREDKEIRYCFYILTSHGLRYECSSVSKVQVDSWLTALRLDCKI 1465
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255537803|ref|XP_002509968.1| conserved hypothetical protein [Ricinus communis] gi|223549867|gb|EEF51355.1| conserved hypothetical protein [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|359473918|ref|XP_002269576.2| PREDICTED: uncharacterized protein LOC100263310 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|388509664|gb|AFK42898.1| unknown [Lotus japonicus] | Back alignment and taxonomy information |
|---|
| >gi|297803746|ref|XP_002869757.1| hypothetical protein ARALYDRAFT_492476 [Arabidopsis lyrata subsp. lyrata] gi|297315593|gb|EFH46016.1| hypothetical protein ARALYDRAFT_492476 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|42573011|ref|NP_974602.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|145333884|ref|NP_001078437.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659421|gb|AEE84821.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659422|gb|AEE84822.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|227204407|dbj|BAH57055.1| AT4G23895 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|334186865|ref|NP_001190817.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659423|gb|AEE84823.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356539323|ref|XP_003538148.1| PREDICTED: uncharacterized protein LOC100803809 [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|449452212|ref|XP_004143854.1| PREDICTED: uncharacterized protein LOC101205585 [Cucumis sativus] gi|449501777|ref|XP_004161455.1| PREDICTED: uncharacterized LOC101205585 [Cucumis sativus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 202 | ||||||
| TAIR|locus:1006230394 | 247 | AT4G23895 [Arabidopsis thalian | 0.915 | 0.748 | 0.743 | 2.5e-72 |
| TAIR|locus:1006230394 AT4G23895 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 731 (262.4 bits), Expect = 2.5e-72, P = 2.5e-72
Identities = 139/187 (74%), Positives = 159/187 (85%)
Query: 1 MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA 60
MLN+F+LR LPWVS DGQEKVEL+A ELESLRSEL+D+E+REA+LKAQLEHVDE+LRSA
Sbjct: 60 MLNLFTLRRLPWVS--DGQEKVELSAAELESLRSELSDMEEREAYLKAQLEHVDEVLRSA 117
Query: 61 RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS 120
RLSGYL+IR+RW LPGEPPPIDDT+VDDWLPRF+VL G C+FFYLLSTDLSPQDST+L+
Sbjct: 118 RLSGYLFIRSRWAALPGEPPPIDDTEVDDWLPRFVVLQGPCLFFYLLSTDLSPQDSTLLA 177
Query: 121 DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPS 180
D+VE+ S+PS TRE E YCFYILTR GLR ECSS SK QV SWLS L+ DCK + E
Sbjct: 178 DIVEIGSVPSYTREFDETHYCFYILTRQGLRFECSSTSKTQVDSWLSVLRLDCKSEPEER 237
Query: 181 TPNGSSE 187
NGS E
Sbjct: 238 LSNGSVE 244
Parameters:
V=100
filter=SEG
E=0.001
ctxfactor=1.00
Query ----- As Used ----- ----- Computed ----
Frame MatID Matrix name Lambda K H Lambda K H
+0 0 BLOSUM62 0.318 0.134 0.410 same same same
Q=9,R=2 0.244 0.0300 0.180 n/a n/a n/a
Query
Frame MatID Length Eff.Length E S W T X E2 S2
+0 0 202 202 0.00090 111 3 11 22 0.36 33
31 0.46 35
Statistics:
Database: /share/blast/go-seqdb.fasta
Title: go_20130330-seqdb.fasta
Posted: 5:47:42 AM PDT Apr 1, 2013
Created: 5:47:42 AM PDT Apr 1, 2013
Format: XDF-1
# of letters in database: 169,044,731
# of sequences in database: 368,745
# of database sequences satisfying E: 1
No. of states in DFA: 611 (65 KB)
Total size of DFA: 188 KB (2107 KB)
Time to generate neighborhood: 0.00u 0.00s 0.00t Elapsed: 00:00:00
No. of threads or processors used: 24
Search cpu time: 19.93u 0.21s 20.14t Elapsed: 00:00:01
Total cpu time: 19.93u 0.21s 20.14t Elapsed: 00:00:01
Start: Thu May 9 19:27:45 2013 End: Thu May 9 19:27:46 2013
|
|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00006750001 | SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (247 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 0.002 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 0.004 |
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
Score = 36.4 bits (84), Expect = 0.002
Identities = 23/112 (20%), Positives = 40/112 (35%), Gaps = 19/112 (16%)
Query: 62 LSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFY---LLSTDLSPQDSTV 118
G+LY ++ W R+ VL S + +Y P+ S
Sbjct: 3 KEGWLYKKSGGG-------------KKSWKKRYFVLFNSTLLYYKSKKDKKSYKPKGSID 49
Query: 119 LSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQ 170
LS V P ++ + +CF I T + + S+ + W+ AL+
Sbjct: 50 LSGC-TVREAPD--PDSSKKPHCFEIKTSDRKTLLLQAESEEEREKWVEALR 98
|
Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. Length = 102 |
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 98.79 | |
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 98.43 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 98.35 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 98.34 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 98.3 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 98.24 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 98.21 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 98.21 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 98.19 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 98.19 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 97.94 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 97.85 | |
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 97.75 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 97.72 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 97.64 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 97.3 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 97.28 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 96.81 | |
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 96.23 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 96.09 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 96.08 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 96.03 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 95.92 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 95.52 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 94.35 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 94.3 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 93.4 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 93.2 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 90.86 | |
| PRK09039 | 343 | hypothetical protein; Validated | 89.38 | |
| KOG0521 | 785 | consensus Putative GTPase activating proteins (GAP | 88.38 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 86.71 |
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
Probab=98.79 E-value=1.1e-08 Score=67.13 Aligned_cols=95 Identities=29% Similarity=0.483 Sum_probs=81.5
Q ss_pred cceeEEEeeecccCCCCCCCCCCCCccccceeeEEeecceeEeeeeec---CCCCCCcceeehhhhccCCCCcc-cCCCc
Q 028879 62 LSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLST---DLSPQDSTVLSDVVEVASLPSIT-RENGE 137 (202)
Q Consensus 62 lSgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~ciffyL~sT---DLsPQdStllsDIVEVg~lP~f~-rEdge 137 (202)
..|||+.++ .-...|=+||+||.|.+|+||-..+ +..|..++-|.++ +|...++.. ....+
T Consensus 3 ~~G~L~~~~--------------~~~~~wk~r~~vL~~~~L~~~~~~~~~~~~~~~~~i~l~~~-~v~~~~~~~~~~~~~ 67 (104)
T PF00169_consen 3 KEGWLLKKS--------------SSRKKWKKRYFVLRDSYLLYYKSSKDKSDSKPKGSIPLDDC-TVRPDPSSDFLSNKK 67 (104)
T ss_dssp EEEEEEEEE--------------SSSSSEEEEEEEEETTEEEEESSTTTTTESSESEEEEGTTE-EEEEETSSTSTSTSS
T ss_pred EEEEEEEEC--------------CCCCCeEEEEEEEECCEEEEEecCccccceeeeEEEEecCc-eEEEcCccccccccC
Confidence 479999999 2345799999999999999999999 7999999999999 888777764 24457
Q ss_pred eEEEEEEEeecceeeeecccceeehhhHHHHhhc
Q 028879 138 MQYCFYILTRHGLRIECSSISKIQVYSWLSALQT 171 (202)
Q Consensus 138 ~~yaFyIlTrhGLR~ECSS~skiQVdsWL~al~~ 171 (202)
..++|.|.+..|=.|..+..++-+...|+.+|+.
T Consensus 68 ~~~~f~i~~~~~~~~~~~~~s~~~~~~W~~~i~~ 101 (104)
T PF00169_consen 68 RKNCFEITTPNGKSYLFSAESEEERKRWIQAIQK 101 (104)
T ss_dssp SSSEEEEEETTSEEEEEEESSHHHHHHHHHHHHH
T ss_pred CCcEEEEEeCCCcEEEEEcCCHHHHHHHHHHHHH
Confidence 7889999999997787777888999999999985
|
The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families: Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D .... |
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PRK09039 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 202 | |||
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 3e-04 |
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 | Back alignment and structure |
|---|
Score = 37.8 bits (88), Expect = 3e-04
Identities = 20/118 (16%), Positives = 38/118 (32%), Gaps = 13/118 (11%)
Query: 63 SGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDV 122
G L+ + L E W F+VL ++ Y TD+ P S +
Sbjct: 3 EGMLHYKAGTSYLGKEH----------WKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGE 52
Query: 123 VEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPS 180
+ + + F ++ +E S+ S+ ++ W+ L P
Sbjct: 53 QCGGCRRA---NTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKGVIPQ 107
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 98.94 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 98.89 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 98.84 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 98.81 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 98.73 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 98.7 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 98.67 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 98.65 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 98.62 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 98.6 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 98.6 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 98.58 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 98.55 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 98.54 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 98.53 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 98.52 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 98.5 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 98.48 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 98.48 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 98.46 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 98.43 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 98.41 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 98.39 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 98.38 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.36 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 98.34 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 98.3 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 98.26 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 98.24 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 98.24 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 98.24 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 98.22 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 98.22 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 98.22 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 98.2 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 98.19 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 98.16 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 98.13 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 98.1 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 98.09 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 98.07 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 98.03 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 98.03 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 98.03 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 97.97 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 97.96 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 97.95 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 97.87 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 97.87 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 97.8 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 97.79 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 97.78 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 97.65 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 97.63 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 97.63 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 97.63 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 97.53 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 97.34 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 96.76 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 96.37 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 96.36 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 96.11 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 93.38 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 92.62 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 91.39 |
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Probab=98.94 E-value=2.3e-09 Score=73.57 Aligned_cols=106 Identities=19% Similarity=0.231 Sum_probs=84.1
Q ss_pred hcceeEEEeeecccCCCCCCCCCCCCccccceeeEEeecceeEeeeeecCCCCCCcceeehhhhccCCCCcccCCCceEE
Q 028879 61 RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQY 140 (202)
Q Consensus 61 rlSgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~ciffyL~sTDLsPQdStllsDIVEVg~lP~f~rEdge~~y 140 (202)
-.+|||+-+.. -..-|=.||+||.|.+++||--..|-.|.+.+-|.++..+-.. .+++...|
T Consensus 6 ~~~G~L~K~g~--------------~~~~Wk~R~fvL~~~~L~yy~~~~~~~~~g~i~L~~~~~~~~~----~~~~~~~~ 67 (113)
T 1pls_A 6 IREGYLVKKGS--------------VFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPC----QDFGKRMF 67 (113)
T ss_dssp SEEEEEEEESS--------------SSSCCEEEEEEEETTEEEEESSTTCSSCSEEEESSSCCEESSC----CSSCCSSS
T ss_pred cEEEEEEEeCC--------------CCCCceEEEEEEECCEEEEEeCCCCCCcceEEEcCCCEEEEec----CCCCCCcc
Confidence 36899998753 2457999999999999999998889999999999988766422 23445678
Q ss_pred EEEEEeecceeeeecccceeehhhHHHHhhccccccCCCCCCCC
Q 028879 141 CFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPSTPNG 184 (202)
Q Consensus 141 aFyIlTrhGLR~ECSS~skiQVdsWL~al~~d~k~~~~~~~~ng 184 (202)
+|-|.|..|=.|..+..++-+.+.|+.+|+.=+........|.+
T Consensus 68 ~F~i~~~~~r~~~l~a~s~~e~~~Wi~ai~~~~~~~~~~~~~~~ 111 (113)
T 1pls_A 68 VFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGLEHHHH 111 (113)
T ss_dssp EEEEEETTTEEEEEECSSHHHHHHHHHHHHHHHHHHTTCCCCCC
T ss_pred EEEEEcCCCCEEEEECCCHHHHHHHHHHHHHHHhccchhhhhcc
Confidence 99999988877888888899999999999976665555555544
|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 202 | ||||
| d1droa_ | 122 | b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila | 8e-05 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 4e-04 | |
| d2i5fa1 | 104 | b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie | 0.003 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 0.003 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 0.004 |
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: beta-spectrin species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 38.7 bits (89), Expect = 8e-05
Identities = 11/115 (9%), Positives = 30/115 (26%), Gaps = 9/115 (7%)
Query: 63 SGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSD- 121
GY+ + W + W ++ I FY
Sbjct: 11 EGYVTRKHEWDSTTKKAS------NRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGE 64
Query: 122 --VVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCK 174
+ I + + ++ + +G + ++ W+++L+
Sbjct: 65 PSYDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQSD 119
|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 202 | |||
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 98.9 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 98.75 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 98.67 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 98.65 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 98.54 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 98.53 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 98.52 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 98.51 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 98.42 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 98.4 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 98.38 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 98.37 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 98.37 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 98.34 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 98.33 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 98.33 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 98.25 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 98.23 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 98.19 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 98.18 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 98.17 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.13 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.09 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 98.01 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 97.98 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 97.93 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 97.77 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 97.76 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 97.72 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 97.56 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 97.51 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 97.49 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 97.07 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 91.51 |
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: PH domain-like barrel superfamily: PH domain-like family: Pleckstrin-homology domain (PH domain) domain: Pleckstrin species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.90 E-value=6.9e-10 Score=71.96 Aligned_cols=96 Identities=17% Similarity=0.272 Sum_probs=71.7
Q ss_pred ceeEEEeeecccCCCCCCCCCCCCccccceeeEEeecc--eeEeeeeecCCCCCCcceeehhhhccCCCCcccCCCceEE
Q 028879 63 SGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGS--CIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQY 140 (202)
Q Consensus 63 SgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~--ciffyL~sTDLsPQdStllsDIVEVg~lP~f~rEdge~~y 140 (202)
+|||+.+++.. .-|-+||+||.|. ++|||=...|-.|.+++.+.++.-+..-+....+.....+
T Consensus 5 ~G~L~k~~~~~--------------k~WkkR~fvL~~~~~~l~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~ 70 (104)
T d2i5fa1 5 QGCLLKQGHRR--------------KNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEEN 70 (104)
T ss_dssp EEEEEEECTTT--------------CCEEEEEEEEETTTTEEEEECTTSCSSCSEEEECTTCEEEEECC--------CCS
T ss_pred EEEEEEECCCC--------------CCcEEEEEEEECCeeEEEEEcCccccCccceEeecceEEEEeccCcccccccCcc
Confidence 79999987542 3699999999865 6677777889999999999886555555555556667888
Q ss_pred EEEEEeecceeeeecccceeehhhHHHHhhcc
Q 028879 141 CFYILTRHGLRIECSSISKIQVYSWLSALQTD 172 (202)
Q Consensus 141 aFyIlTrhGLR~ECSS~skiQVdsWL~al~~d 172 (202)
+|.+.|..|-.|.-...++-..++|+.||+.-
T Consensus 71 ~~~~~~~~~~~~~~~a~s~~e~~~W~~ai~~a 102 (104)
T d2i5fa1 71 LFEIITADEVHYFLQAATPKERTEWIKAIQMA 102 (104)
T ss_dssp EEEEECTTCCEEEEECSSHHHHHHHHHHHHHH
T ss_pred EEEEECCCCeEEEEEcCCHHHHHHHHHHHHHH
Confidence 99999999987776677888999999999864
|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|