Citrus Sinensis ID: 028879


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPSTPNGSSENNCQICTWVKKTEIR
cccccccccccccccccccccEEEEHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccEEEEEEEccEEEEEEEccccccccccEEEHHHHcccccccccccccEEEEEEEEEEccEEEEEccccEEEHHHHHHHHHccccccccccccccccccccccccEEEEcccc
ccccccccccccccccccccEEEEEHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEHHHHccccccccccccccccccccEEEEEccEEEEEEEccccccccccHHHHEEEcccccccccccccEEEEEEEEEccccEEEEccccEEEHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEcc
mlnmfslrglpwvsssdgqeKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIrtrwkplpgepppiddtdvddwlpRFIVLHGSCIFFYLlstdlspqdstvlSDVVEvaslpsitrengemQYCFYILTRhglriecssiskIQVYSWLSALQtdckldyepstpngssenncqiCTWVKKTEIR
mlnmfslrglpwvsssdgqEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTrwkplpgepppiDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVAslpsitrengeMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYepstpngssenncqictwvkkteir
MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPSTPNGSSENNCQICTWVKKTEIR
***********************************************AQLEHVDEILRSARLSGYLYIRTRWKPLPGE*PPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDY***********NCQICTWVK*****
*****S*R***************LTATELESLRS**********HLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQT***********************WVKKTEI*
MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYE********ENNCQICTWVKKTEIR
*LNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLD**********ENNCQICTWVKKTEIR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLNMFSLRGLPWVSSSDGQEKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLRSARLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPSTPNGSSENNCQICTWVKKTEIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
297742337 1479 unnamed protein product [Vitis vinifera] 0.866 0.118 0.805 1e-81
255537803245 conserved hypothetical protein [Ricinus 0.920 0.759 0.796 2e-80
359473918 521 PREDICTED: uncharacterized protein LOC10 0.881 0.341 0.797 4e-80
388509664188 unknown [Lotus japonicus] 0.915 0.984 0.745 6e-77
297803746247 hypothetical protein ARALYDRAFT_492476 [ 0.915 0.748 0.764 6e-77
42573011247 Pleckstrin homology (PH) domain-containi 0.915 0.748 0.743 2e-75
227204407188 AT4G23895 [Arabidopsis thaliana] 0.915 0.984 0.743 5e-75
334186865 467 Pleckstrin homology (PH) domain-containi 0.871 0.376 0.758 1e-74
356539323189 PREDICTED: uncharacterized protein LOC10 0.925 0.989 0.739 1e-74
449452212252 PREDICTED: uncharacterized protein LOC10 0.881 0.706 0.751 9e-72
>gi|297742337|emb|CBI34486.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score =  307 bits (787), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 141/175 (80%), Positives = 159/175 (90%)

Query: 1    MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA 60
            MLN+FSLRGLPW SSSD QEKVELT  ELESLR+ELA LE+REAH KAQLEHVDEILRSA
Sbjct: 1291 MLNLFSLRGLPWGSSSDDQEKVELTVAELESLRTELASLEEREAHFKAQLEHVDEILRSA 1350

Query: 61   RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS 120
            RLSGYLYIRTRW  LPGEPPPIDDT+VDDWLPRF+VLHGSC+FFY+LSTDLSPQDST+LS
Sbjct: 1351 RLSGYLYIRTRWAALPGEPPPIDDTEVDDWLPRFVVLHGSCLFFYMLSTDLSPQDSTLLS 1410

Query: 121  DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKL 175
            DV EV  LP++TRE+ E++YCFYILT HGLR ECSS+SK+QV SWL+AL+ DCK+
Sbjct: 1411 DVTEVGPLPNLTREDKEIRYCFYILTSHGLRYECSSVSKVQVDSWLTALRLDCKI 1465




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255537803|ref|XP_002509968.1| conserved hypothetical protein [Ricinus communis] gi|223549867|gb|EEF51355.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|359473918|ref|XP_002269576.2| PREDICTED: uncharacterized protein LOC100263310 [Vitis vinifera] Back     alignment and taxonomy information
>gi|388509664|gb|AFK42898.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|297803746|ref|XP_002869757.1| hypothetical protein ARALYDRAFT_492476 [Arabidopsis lyrata subsp. lyrata] gi|297315593|gb|EFH46016.1| hypothetical protein ARALYDRAFT_492476 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|42573011|ref|NP_974602.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|145333884|ref|NP_001078437.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659421|gb|AEE84821.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659422|gb|AEE84822.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|227204407|dbj|BAH57055.1| AT4G23895 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|334186865|ref|NP_001190817.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] gi|332659423|gb|AEE84823.1| Pleckstrin homology (PH) domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356539323|ref|XP_003538148.1| PREDICTED: uncharacterized protein LOC100803809 [Glycine max] Back     alignment and taxonomy information
>gi|449452212|ref|XP_004143854.1| PREDICTED: uncharacterized protein LOC101205585 [Cucumis sativus] gi|449501777|ref|XP_004161455.1| PREDICTED: uncharacterized LOC101205585 [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query202
TAIR|locus:1006230394247 AT4G23895 [Arabidopsis thalian 0.915 0.748 0.743 2.5e-72
TAIR|locus:1006230394 AT4G23895 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 731 (262.4 bits), Expect = 2.5e-72, P = 2.5e-72
 Identities = 139/187 (74%), Positives = 159/187 (85%)

Query:     1 MLNMFSLRGLPWVSSSDGQEKVELTATELESLRSELADLEDREAHLKAQLEHVDEILRSA 60
             MLN+F+LR LPWVS  DGQEKVEL+A ELESLRSEL+D+E+REA+LKAQLEHVDE+LRSA
Sbjct:    60 MLNLFTLRRLPWVS--DGQEKVELSAAELESLRSELSDMEEREAYLKAQLEHVDEVLRSA 117

Query:    61 RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLS 120
             RLSGYL+IR+RW  LPGEPPPIDDT+VDDWLPRF+VL G C+FFYLLSTDLSPQDST+L+
Sbjct:   118 RLSGYLFIRSRWAALPGEPPPIDDTEVDDWLPRFVVLQGPCLFFYLLSTDLSPQDSTLLA 177

Query:   121 DVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPS 180
             D+VE+ S+PS TRE  E  YCFYILTR GLR ECSS SK QV SWLS L+ DCK + E  
Sbjct:   178 DIVEIGSVPSYTREFDETHYCFYILTRQGLRFECSSTSKTQVDSWLSVLRLDCKSEPEER 237

Query:   181 TPNGSSE 187
               NGS E
Sbjct:   238 LSNGSVE 244


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.134   0.410    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      202       202   0.00090  111 3  11 22  0.36    33
                                                     31  0.46    35


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  611 (65 KB)
  Total size of DFA:  188 KB (2107 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  19.93u 0.21s 20.14t   Elapsed:  00:00:01
  Total cpu time:  19.93u 0.21s 20.14t   Elapsed:  00:00:01
  Start:  Thu May  9 19:27:45 2013   End:  Thu May  9 19:27:46 2013


GO:0004550 "nucleoside diphosphate kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005543 "phospholipid binding" evidence=IEA
GO:0005634 "nucleus" evidence=ISM
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=IEA
GO:0006183 "GTP biosynthetic process" evidence=IEA
GO:0006228 "UTP biosynthetic process" evidence=IEA
GO:0006241 "CTP biosynthetic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00006750001
SubName- Full=Chromosome chr2 scaffold_176, whole genome shotgun sequence; (247 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
smart00233102 smart00233, PH, Pleckstrin homology domain 0.002
pfam00169101 pfam00169, PH, PH domain 0.004
>gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain Back     alignment and domain information
 Score = 36.4 bits (84), Expect = 0.002
 Identities = 23/112 (20%), Positives = 40/112 (35%), Gaps = 19/112 (16%)

Query: 62  LSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFY---LLSTDLSPQDSTV 118
             G+LY ++                   W  R+ VL  S + +Y          P+ S  
Sbjct: 3   KEGWLYKKSGGG-------------KKSWKKRYFVLFNSTLLYYKSKKDKKSYKPKGSID 49

Query: 119 LSDVVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQ 170
           LS    V   P    ++ +  +CF I T     +   + S+ +   W+ AL+
Sbjct: 50  LSGC-TVREAPD--PDSSKKPHCFEIKTSDRKTLLLQAESEEEREKWVEALR 98


Domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. Length = 102

>gnl|CDD|215766 pfam00169, PH, PH domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 202
PF00169104 PH: PH domain; InterPro: IPR001849 The pleckstrin 98.79
smart00233102 PH Pleckstrin homology domain. Domain commonly fou 98.43
cd0082196 PH Pleckstrin homology (PH) domain. Pleckstrin hom 98.35
cd0124691 PH_oxysterol_bp Oxysterol binding protein (OSBP) P 98.34
cd01253104 PH_beta_spectrin Beta-spectrin pleckstrin homology 98.3
cd0125094 PH_centaurin Centaurin Pleckstrin homology (PH) do 98.24
cd01252125 PH_cytohesin Cytohesin Pleckstrin homology (PH) do 98.21
cd01235101 PH_SETbf Set binding factor Pleckstrin Homology (P 98.21
cd01233100 Unc104 Unc-104 pleckstrin homology (PH) domain. Un 98.19
cd01238106 PH_Tec Tec pleckstrin homology (PH) domain. Tec pl 98.19
cd0126096 PH_CNK Connector enhancer of KSR (Kinase suppresso 97.94
cd0126595 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain 97.85
cd01251103 PH_centaurin_alpha Centaurin alpha Pleckstrin homo 97.75
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 97.72
cd0124791 PH_GPBP Goodpasture antigen binding protein (GPBP) 97.64
cd01266108 PH_Gab Gab (Grb2-associated binder) pleckstrin hom 97.3
cd01263122 PH_anillin Anillin Pleckstrin homology (PH) domain 97.28
cd0124598 PH_RasGAP_CG5898 RAS GTPase-activating protein (GA 96.81
cd0124498 PH_RasGAP_CG9209 RAS_GTPase activating protein (GA 96.23
cd01257101 PH_IRS Insulin receptor substrate (IRS) pleckstrin 96.09
cd01241102 PH_Akt Akt pleckstrin homology (PH) domain. Akt pl 96.08
cd01236104 PH_outspread Outspread Pleckstrin homology (PH) do 96.03
cd01264101 PH_melted Melted pleckstrin homology (PH) domain. 95.92
cd01230117 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 95.52
PF15410119 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN 94.35
cd01254121 PH_PLD Phospholipase D (PLD) pleckstrin homology ( 94.3
cd01219101 PH_FGD FGD (faciogenital dysplasia protein) plecks 93.4
cd01249104 PH_oligophrenin Oligophrenin Pleckstrin homology ( 93.2
cd01258108 PH_syntrophin Syntrophin pleckstrin homology (PH) 90.86
PRK09039343 hypothetical protein; Validated 89.38
KOG0521 785 consensus Putative GTPase activating proteins (GAP 88.38
PF15413112 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE 86.71
>PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] Back     alignment and domain information
Probab=98.79  E-value=1.1e-08  Score=67.13  Aligned_cols=95  Identities=29%  Similarity=0.483  Sum_probs=81.5

Q ss_pred             cceeEEEeeecccCCCCCCCCCCCCccccceeeEEeecceeEeeeeec---CCCCCCcceeehhhhccCCCCcc-cCCCc
Q 028879           62 LSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLST---DLSPQDSTVLSDVVEVASLPSIT-RENGE  137 (202)
Q Consensus        62 lSgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~ciffyL~sT---DLsPQdStllsDIVEVg~lP~f~-rEdge  137 (202)
                      ..|||+.++              .-...|=+||+||.|.+|+||-..+   +..|..++-|.++ +|...++.. ....+
T Consensus         3 ~~G~L~~~~--------------~~~~~wk~r~~vL~~~~L~~~~~~~~~~~~~~~~~i~l~~~-~v~~~~~~~~~~~~~   67 (104)
T PF00169_consen    3 KEGWLLKKS--------------SSRKKWKKRYFVLRDSYLLYYKSSKDKSDSKPKGSIPLDDC-TVRPDPSSDFLSNKK   67 (104)
T ss_dssp             EEEEEEEEE--------------SSSSSEEEEEEEEETTEEEEESSTTTTTESSESEEEEGTTE-EEEEETSSTSTSTSS
T ss_pred             EEEEEEEEC--------------CCCCCeEEEEEEEECCEEEEEecCccccceeeeEEEEecCc-eEEEcCccccccccC
Confidence            479999999              2345799999999999999999999   7999999999999 888777764 24457


Q ss_pred             eEEEEEEEeecceeeeecccceeehhhHHHHhhc
Q 028879          138 MQYCFYILTRHGLRIECSSISKIQVYSWLSALQT  171 (202)
Q Consensus       138 ~~yaFyIlTrhGLR~ECSS~skiQVdsWL~al~~  171 (202)
                      ..++|.|.+..|=.|..+..++-+...|+.+|+.
T Consensus        68 ~~~~f~i~~~~~~~~~~~~~s~~~~~~W~~~i~~  101 (104)
T PF00169_consen   68 RKNCFEITTPNGKSYLFSAESEEERKRWIQAIQK  101 (104)
T ss_dssp             SSSEEEEEETTSEEEEEEESSHHHHHHHHHHHHH
T ss_pred             CCcEEEEEeCCCcEEEEEcCCHHHHHHHHHHHHH
Confidence            7889999999997787777888999999999985



The pleckstrin homology domain commonly found in eukaryotic signalling proteins. The domain family possesses multiple functions including the abilities to bind inositol phosphates, and various proteins. PH domains have been found to possess inserted domains (such as in PLC gamma, syntrophins) and to be inserted within other domains. Mutations in Brutons tyrosine kinase (Btk) within its PH domain cause X-linked agammaglobulinaemia (XLA) in patients. Point mutations cluster into the positively charged end of the molecule around the predicted binding site for phosphatidylinositol lipids. The 3D structure of several PH domains has been determined []. All known cases have a common structure consisting of two perpendicular anti-parallel beta sheets, followed by a C-terminal amphipathic helix. The loops connecting the beta-strands differ greatly in length, making the PH domain relatively difficult to detect. There are no totally invariant residues within the PH domain. Proteins reported to contain one more PH domains belong to the following families: Pleckstrin, the protein where this domain was first detected, is the major substrate of protein kinase C in platelets. Pleckstrin is one of the rare proteins to contains two PH domains. Ser/Thr protein kinases such as the Akt/Rac family, the beta-adrenergic receptor kinases, the mu isoform of PKC and the trypanosomal NrkA family. Tyrosine protein kinases belonging to the Btk/Itk/Tec subfamily. Insulin Receptor Substrate 1 (IRS-1). Regulators of small G-proteins like guanine nucleotide releasing factor GNRP (Ras-GRF) (which contains 2 PH domains), guanine nucleotide exchange proteins like vav, dbl, SoS and Saccharomyces cerevisiae CDC24, GTPase activating proteins like rasGAP and BEM2/IPL2, and the human break point cluster protein bcr. Cytoskeletal proteins such as dynamin (see IPR001401 from INTERPRO), Caenorhabditis elegans kinesin-like protein unc-104 (see IPR001752 from INTERPRO), spectrin beta-chain, syntrophin (2 PH domains) and S. cerevisiae nuclear migration protein NUM1. Mammalian phosphatidylinositol-specific phospholipase C (PI-PLC) (see IPR000909 from INTERPRO) isoforms gamma and delta. Isoform gamma contains two PH domains, the second one is split into two parts separated by about 400 residues. Oxysterol binding proteins OSBP, S. cerevisiae OSH1 and YHR073w. Mouse protein citron, a putative rho/rac effector that binds to the GTP-bound forms of rho and rac. Several S. cerevisiae proteins involved in cell cycle regulation and bud formation like BEM2, BEM3, BUD4 and the BEM1-binding proteins BOI2 (BEB1) and BOI1 (BOB1). C. elegans protein MIG-10. C. elegans hypothetical proteins C04D8.1, K06H7.4 and ZK632.12. S. cerevisiae hypothetical proteins YBR129c and YHR155w. ; GO: 0005515 protein binding; PDB: 1DYN_B 2DYN_B 3SNH_A 3ZYS_C 1X05_A 2I5F_A 1ZM0_B 1XX0_A 2I5C_C 3A8P_D ....

>smart00233 PH Pleckstrin homology domain Back     alignment and domain information
>cd00821 PH Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain Back     alignment and domain information
>cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain Back     alignment and domain information
>cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain Back     alignment and domain information
>cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain Back     alignment and domain information
>cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01241 PH_Akt Akt pleckstrin homology (PH) domain Back     alignment and domain information
>cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01264 PH_melted Melted pleckstrin homology (PH) domain Back     alignment and domain information
>cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain Back     alignment and domain information
>PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A Back     alignment and domain information
>cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain Back     alignment and domain information
>cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain Back     alignment and domain information
>cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>KOG0521 consensus Putative GTPase activating proteins (GAPs) [Signal transduction mechanisms] Back     alignment and domain information
>PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query202
3cxb_B112 Pleckstrin homology domain-containing family M mem 3e-04
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Length = 112 Back     alignment and structure
 Score = 37.8 bits (88), Expect = 3e-04
 Identities = 20/118 (16%), Positives = 38/118 (32%), Gaps = 13/118 (11%)

Query: 63  SGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDV 122
            G L+ +     L  E           W   F+VL    ++ Y   TD+ P  S  +   
Sbjct: 3   EGMLHYKAGTSYLGKEH----------WKTCFVVLSNGILYQYPDRTDVIPLLSVNMGGE 52

Query: 123 VEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPS 180
                  +      +  + F ++      +E S+ S+ ++  W+  L         P 
Sbjct: 53  QCGGCRRA---NTTDRPHAFQVILSDRPCLELSAESEAEMAEWMQHLCQAVSKGVIPQ 107


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
1pls_A113 Pleckstrin homology domain; phosphorylation; NMR { 98.94
1wgq_A109 FYVE, rhogef and PH domain containing 6; ethanol d 98.89
2i5f_A109 Pleckstrin; PH domain, protein-inositol phosphate 98.84
1u5d_A108 SKAP55, SRC kinase-associated phosphoprotein of 55 98.81
1x05_A129 Pleckstrin; PH domain, structural genomics, NPPSFA 98.73
2d9y_A117 Pleckstrin homology domain-containing protein fami 98.7
1v89_A118 Hypothetical protein KIAA0053; pleckstrin homology 98.67
1u5f_A148 SRC-associated adaptor protein; PH domain of SKAP- 98.65
2dn6_A115 KIAA0640 protein; PH domain, structural genomics, 98.62
2yry_A122 Pleckstrin homology domain-containing family A mem 98.6
1eaz_A125 Tandem PH domain containing protein-1; lipid-bindi 98.6
3rcp_A103 Pleckstrin homology domain-containing family A ME; 98.58
1upq_A123 PEPP1; PH domain, phosphoinositide binding, signal 98.55
2cod_A115 Centaurin-delta 1; ARF GAP and RHO GAP with ankyri 98.54
1fao_A126 Dual adaptor of phosphotyrosine and 3- phosphoinos 98.53
3aj4_A112 Pleckstrin homology domain-containing family B ME; 98.52
2dkp_A128 Pleckstrin homology domain-containing family A mem 98.5
1fgy_A127 GRP1; PH domain, signaling protein; HET: 4IP; 1.50 98.48
1x1g_A129 Pleckstrin 2; PH domain, structural genomics, rike 98.48
2d9v_A130 Pleckstrin homology domain-containing protein fami 98.46
1v5u_A117 SBF1, SET binding factor 1; MTMR5, the pleckstrin 98.43
1btn_A106 Beta-spectrin; signal transduction protein; HET: I 98.41
2y7b_A134 Actin-binding protein anillin; cell cycle; 1.90A { 98.39
1v5p_A126 Pleckstrin homology domain-containing, family A; T 98.38
2w2x_D124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.36
2cof_A107 Protein KIAA1914; PH domain, structural genomics, 98.34
2d9x_A120 Oxysterol binding protein-related protein 11; PH d 98.3
2dhk_A119 TBC1 domain family member 2; PH domain, paris-1, s 98.26
1v88_A130 Oxysterol binding protein-related protein 8; vesic 98.24
4h8s_A407 DCC-interacting protein 13-beta; BAR domain, pleck 98.24
3cxb_B112 Pleckstrin homology domain-containing family M mem 98.24
1u5e_A211 SRC-associated adaptor protein; novel dimerization 98.22
3tca_A291 Amyloid beta A4 precursor protein-binding family 1 98.22
1unq_A125 RAC-alpha serine/threonine kinase; transferase, pl 98.22
2dtc_A126 RAL guanine nucleotide exchange factor ralgps1A; P 98.2
1wi1_A126 Calcium-dependent activator protein for secretion, 98.19
2lul_A164 Tyrosine-protein kinase TEC; structural genomics, 98.16
2rsg_A94 Collagen type IV alpha-3-binding protein; pleckstr 98.13
2coc_A112 FYVE, rhogef and PH domain containing protein 3; s 98.1
1x1f_A149 Signal-transducing adaptor protein 1; docking prot 98.09
2j59_M168 RHO-GTPase activating protein 10; ARF, ARF1, ARFBD 98.07
1wg7_A150 Dedicator of cytokinesis protein 9; pleckstrin hom 98.03
1btk_A169 Bruton'S tyrosine kinase; transferase, PH domain, 98.03
2da0_A114 130-kDa phosphatidylinositol 4,5-biphosphate- depe 98.03
2rlo_A128 Centaurin-gamma 1; split PH domain, alternative sp 97.97
1dro_A122 Beta-spectrin; cytoskeleton; NMR {Drosophila melan 97.96
2p0d_A129 RHO GTPase-activating protein 9; protein-phosphoin 97.95
1wjm_A123 Beta-spectrin III; PH domain, signal transduction, 97.87
2q13_A385 DCC-interacting protein 13 alpha; APPL1, BAR domai 97.87
2r09_A347 Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph 97.8
3pp2_A124 RHO GTPase-activating protein 27; PH domain, GTPas 97.79
3a8p_A 263 T-lymphoma invasion and metastasis-inducing protei 97.78
1qqg_A 264 IRS-1, insulin receptor substrate 1; beta-sandwhic 97.65
4a6h_A120 Phosphatidylinositol 4,5-bisphosphate-binding Pro 97.63
3tfm_A228 Myosin X; split PH domain, motor protein; 2.53A {R 97.63
3lju_X386 ARF-GAP with dual PH domain-containing protein 1; 97.63
2rov_A117 RHO-associated protein kinase 2; ATP-binding, coil 97.53
3lju_X 386 ARF-GAP with dual PH domain-containing protein 1; 97.34
4gmv_A281 RAS-associated and pleckstrin homology domains-CO 96.76
1dyn_A125 Dynamin; signal transduction protein; 2.20A {Homo 96.37
3a8n_A 279 TIAM-1, T-lymphoma invasion and metastasis-inducin 96.36
3hk0_A256 Growth factor receptor-bound protein 10; GRB10, RA 96.11
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 93.38
2ys3_A137 UNC-112-related protein 2; PH domain, kindlin-3, s 92.62
2fjl_A150 1-phosphatidylinositol-4,5-bisphosphate phosphodie 91.39
>1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
Probab=98.94  E-value=2.3e-09  Score=73.57  Aligned_cols=106  Identities=19%  Similarity=0.231  Sum_probs=84.1

Q ss_pred             hcceeEEEeeecccCCCCCCCCCCCCccccceeeEEeecceeEeeeeecCCCCCCcceeehhhhccCCCCcccCCCceEE
Q 028879           61 RLSGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQY  140 (202)
Q Consensus        61 rlSgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~ciffyL~sTDLsPQdStllsDIVEVg~lP~f~rEdge~~y  140 (202)
                      -.+|||+-+..              -..-|=.||+||.|.+++||--..|-.|.+.+-|.++..+-..    .+++...|
T Consensus         6 ~~~G~L~K~g~--------------~~~~Wk~R~fvL~~~~L~yy~~~~~~~~~g~i~L~~~~~~~~~----~~~~~~~~   67 (113)
T 1pls_A            6 IREGYLVKKGS--------------VFNTWKPMWVVLLEDGIEFYKKKSDNSPKGMIPLKGSTLTSPC----QDFGKRMF   67 (113)
T ss_dssp             SEEEEEEEESS--------------SSSCCEEEEEEEETTEEEEESSTTCSSCSEEEESSSCCEESSC----CSSCCSSS
T ss_pred             cEEEEEEEeCC--------------CCCCceEEEEEEECCEEEEEeCCCCCCcceEEEcCCCEEEEec----CCCCCCcc
Confidence            36899998753              2457999999999999999998889999999999988766422    23445678


Q ss_pred             EEEEEeecceeeeecccceeehhhHHHHhhccccccCCCCCCCC
Q 028879          141 CFYILTRHGLRIECSSISKIQVYSWLSALQTDCKLDYEPSTPNG  184 (202)
Q Consensus       141 aFyIlTrhGLR~ECSS~skiQVdsWL~al~~d~k~~~~~~~~ng  184 (202)
                      +|-|.|..|=.|..+..++-+.+.|+.+|+.=+........|.+
T Consensus        68 ~F~i~~~~~r~~~l~a~s~~e~~~Wi~ai~~~~~~~~~~~~~~~  111 (113)
T 1pls_A           68 VFKITTTKQQDHFFQAAFLEERDAWVRDINKAIKCIEGLEHHHH  111 (113)
T ss_dssp             EEEEEETTTEEEEEECSSHHHHHHHHHHHHHHHHHHTTCCCCCC
T ss_pred             EEEEEcCCCCEEEEECCCHHHHHHHHHHHHHHHhccchhhhhcc
Confidence            99999988877888888899999999999976665555555544



>1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A Back     alignment and structure
>1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A Back     alignment and structure
>2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A Back     alignment and structure
>2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Back     alignment and structure
>1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* Back     alignment and structure
>2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A Back     alignment and structure
>3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Back     alignment and structure
>2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} Back     alignment and structure
>1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* Back     alignment and structure
>1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A Back     alignment and structure
>2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} Back     alignment and structure
>1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Back     alignment and structure
>2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A Back     alignment and structure
>2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} Back     alignment and structure
>3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B Back     alignment and structure
>1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A Back     alignment and structure
>2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} Back     alignment and structure
>1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} Back     alignment and structure
>2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} Back     alignment and structure
>2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A Back     alignment and structure
>1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* Back     alignment and structure
>2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Back     alignment and structure
>1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 Back     alignment and structure
>2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* Back     alignment and structure
>1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 Back     alignment and structure
>2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A Back     alignment and structure
>2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* Back     alignment and structure
>3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} Back     alignment and structure
>3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A Back     alignment and structure
>1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* Back     alignment and structure
>4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A Back     alignment and structure
>3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} Back     alignment and structure
>3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A Back     alignment and structure
>3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 202
d1droa_122 b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila 8e-05
d1u5ea1209 b.55.1.1 (A:14-222) Src-associated adaptor protein 4e-04
d2i5fa1104 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapie 0.003
d1upqa_107 b.55.1.1 (A:) Phosphoinositol 3-phosphate binding 0.003
d1u5da1106 b.55.1.1 (A:108-213) Src kinase-associated phospho 0.004
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: beta-spectrin
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score = 38.7 bits (89), Expect = 8e-05
 Identities = 11/115 (9%), Positives = 30/115 (26%), Gaps = 9/115 (7%)

Query: 63  SGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGSCIFFYLLSTDLSPQDSTVLSD- 121
            GY+  +  W     +           W   ++      I FY                 
Sbjct: 11  EGYVTRKHEWDSTTKKAS------NRSWDKVYMAAKAGRISFYKDQKGYKSNPELTFRGE 64

Query: 122 --VVEVASLPSITRENGEMQYCFYILTRHGLRIECSSISKIQVYSWLSALQTDCK 174
                  +   I  +  + ++   +   +G      +    ++  W+++L+    
Sbjct: 65  PSYDLQNAAIEIASDYTKKKHVLRVKLANGALFLLQAHDDTEMSQWVTSLKAQSD 119


>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 Back     information, alignment and structure
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query202
d2i5fa1104 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1u5fa1111 Src-associated adaptor protein Skap2 {Mouse (Mus m 98.75
d1upqa_107 Phosphoinositol 3-phosphate binding protein-1, PEP 98.67
d1u5da1106 Src kinase-associated phosphoprotein SKAP55 (SCAP1 98.65
d1plsa_113 Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} 98.55
d1wgqa_109 FYVE, RhoGEF and PH domain containing protein 6, F 98.54
d1faoa_100 Dual adaptor of phosphotyrosine and 3-phosphoinosi 98.53
d2fjla1101 Phosphoinositide phospholipase C, PLC-gamma-1 {Rat 98.52
d1v88a_130 Oxysterol binding protein-related protein 8 (ORP-8 98.51
d1wjma_123 beta-spectrin {Human (Homo sapiens), brain 2 isofo 98.42
d2cofa195 KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} 98.4
d1x1fa1136 Signal-transducing adaptor protein 1, STAP-1 {Huma 98.38
d2elba2101 DCC-interacting protein 13-alpha, APPL1 {Human (Ho 98.37
d2coaa1112 Protein kinase c, d2 type {Human (Homo sapiens) [T 98.37
d2coca199 FYVE, RhoGEF and PH domain containing protein 3, F 98.34
d1v5ua_117 SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ 98.33
d1v89a_118 Rho-GTPase-activating protein 25 (KIAA0053) {Human 98.33
d1wi1a_126 Calcium-dependent activator protein for secretion, 98.25
d1btna_106 beta-spectrin {Mouse (Mus musculus), brain [TaxId: 98.23
d2j59m1133 Rho GTPase-activating protein 21 {Human (Homo sapi 98.19
d1u5ea1209 Src-associated adaptor protein Skap2 {Mouse (Mus m 98.18
d1omwa2119 G-protein coupled receptor kinase 2 (beta-adrenerg 98.17
d1eaza_103 Tapp1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1x1ga1116 Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d1v5pa_126 Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} 98.09
d1droa_122 beta-spectrin {Fruit fly (Drosophila melanogaster) 98.01
d1v5ma_136 SH2 and PH domain-containing adapter protein APS { 97.98
d1unqa_118 Rac-alpha serine/threonine kinase {Human (Homo sap 97.93
d2dyna_111 Dynamin {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1qqga1103 Insulin receptor substrate 1, IRS-1 {Human (Homo s 97.76
d1fgya_127 Grp1 {Mouse (Mus musculus) [TaxId: 10090]} 97.72
d1btka_169 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 97.56
d1wg7a_150 Dedicator of cytokinesis protein 9, DOCK9 {Human ( 97.51
d2coda1102 Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 97.49
d1w1ha_147 3-phosphoinositide dependent protein kinase-1 {Hum 97.07
d1maia_119 Phospholipase C delta-1 {Rat (Rattus norvegicus) [ 91.51
>d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Pleckstrin-homology domain (PH domain)
domain: Pleckstrin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.90  E-value=6.9e-10  Score=71.96  Aligned_cols=96  Identities=17%  Similarity=0.272  Sum_probs=71.7

Q ss_pred             ceeEEEeeecccCCCCCCCCCCCCccccceeeEEeecc--eeEeeeeecCCCCCCcceeehhhhccCCCCcccCCCceEE
Q 028879           63 SGYLYIRTRWKPLPGEPPPIDDTDVDDWLPRFIVLHGS--CIFFYLLSTDLSPQDSTVLSDVVEVASLPSITRENGEMQY  140 (202)
Q Consensus        63 SgYLyiRtRW~aLpgEpppiDDtdVDDWlpRFVVl~G~--ciffyL~sTDLsPQdStllsDIVEVg~lP~f~rEdge~~y  140 (202)
                      +|||+.+++..              .-|-+||+||.|.  ++|||=...|-.|.+++.+.++.-+..-+....+.....+
T Consensus         5 ~G~L~k~~~~~--------------k~WkkR~fvL~~~~~~l~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~   70 (104)
T d2i5fa1           5 QGCLLKQGHRR--------------KNWKVRKFILREDPAYLHYYDPAGAEDPLGAIHLRGCVVTSVESNSNGRKSEEEN   70 (104)
T ss_dssp             EEEEEEECTTT--------------CCEEEEEEEEETTTTEEEEECTTSCSSCSEEEECTTCEEEEECC--------CCS
T ss_pred             EEEEEEECCCC--------------CCcEEEEEEEECCeeEEEEEcCccccCccceEeecceEEEEeccCcccccccCcc
Confidence            79999987542              3699999999865  6677777889999999999886555555555556667888


Q ss_pred             EEEEEeecceeeeecccceeehhhHHHHhhcc
Q 028879          141 CFYILTRHGLRIECSSISKIQVYSWLSALQTD  172 (202)
Q Consensus       141 aFyIlTrhGLR~ECSS~skiQVdsWL~al~~d  172 (202)
                      +|.+.|..|-.|.-...++-..++|+.||+.-
T Consensus        71 ~~~~~~~~~~~~~~~a~s~~e~~~W~~ai~~a  102 (104)
T d2i5fa1          71 LFEIITADEVHYFLQAATPKERTEWIKAIQMA  102 (104)
T ss_dssp             EEEEECTTCCEEEEECSSHHHHHHHHHHHHHH
T ss_pred             EEEEECCCCeEEEEEcCCHHHHHHHHHHHHHH
Confidence            99999999987776677888999999999864



>d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} Back     information, alignment and structure
>d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} Back     information, alignment and structure
>d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure