Citrus Sinensis ID: 028884


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MGCSGSVPARSSGQSGGLNNLENAGSSDAKNLRVKLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYAALAPLYYRGAAVAVVVYDITSPDSFNKAQYWVKELQKHGSPDIVMALVGNKADLHEKREVPAQDGIEYAEKNGMFFIETSAKTADNINQLFEEIAKRLPRPSPSS
ccccccccccccccccccccccccccccccEEEEEEEEEccccccHHHHHHHHHcccccccccccccEEEEccEEEEccccEEEEEEEEcccccccccccHHHHHcccEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccHHHHHHHHHHcccEEEEccccccccHHHHHHHHHHHcccccccc
*******************************LRVKLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYAALAPLYYRGAAVAVVVYDITSPDSFNKAQYWVKELQKHGSPDIVMALVGNKADLHEKREVPAQDGIEYAEKNGMFFIETSAKTADNINQLFEEIAK**PR*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCSGSVPARSSGQSGGLNNLENAGSSDAKNLRVKLVLLGDSGVGKSCIVLRFVRGQFDPTSKVTVGASFLSQTIALQDSTTVKFEIWDTAGQERYAALAPLYYRGAAVAVVVYDITSPDSFNKAQYWVKELQKHGSPDIVMALVGNKADLHEKREVPAQDGIEYAEKNGMFFIETSAKTADNINQLFEEIAKRLPRPSPSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras-related protein RABF1 Endosomal protein probably involved in endocytosis. Probably not involved in vacuolar trafficking.confidentQ9CB01
Ras-related protein Rab-5C Protein transport. Probably involved in vesicular traffic.probableP51148
Ras-related protein Rab-5C Protein transport. Probably involved in vesicular traffic.probableQ98932

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2G6B, chain A
Confidence level:very confident
Coverage over the Query: 28-197
View the alignment between query and template
View the model in PyMOL
Template: 3L0I, chain B
Confidence level:very confident
Coverage over the Query: 27-198
View the alignment between query and template
View the model in PyMOL