Citrus Sinensis ID: 028895

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--
MASSKERENFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERFVRYYMHCW
cccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHcHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHccc
********NFVYVAKLAEQAERYDEMVDAMKNVAKLDVELTVEERNLLSVGYKNVIGARRASWRILSS***************RIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERFVRYYMHCW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSKERENFVYxxxxxxxxxxxxxxxxxxxxxAKLDVELTVEERNLLSVGYKNVIGARRASWRILSSIEQKEEAKGNEVNAKRIKEYRQKVESELSDICNDIMTVIDEHLIPSASAGESTVFFYKMKGDYYRYLAEFKFGDEKKEAAANSMKAYETATTAAEADLPPTHPIRLGLALNFSVFYYEIMNSPERFVRYYMHCW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
14-3-3 protein epsilon Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.probableQ5ZMT0
14-3-3-like protein probableP54632
14-3-3-like protein D probableQ96453

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UBW, chain A
Confidence level:very confident
Coverage over the Query: 6-202
View the alignment between query and template
View the model in PyMOL