BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028940
         (201 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4GL2|A Chain A, Structural Basis For Dsrna Duplex Backbone Recognition By
           Mda5
 pdb|4GL2|B Chain B, Structural Basis For Dsrna Duplex Backbone Recognition By
           Mda5
          Length = 699

 Score = 28.5 bits (62), Expect = 2.5,   Method: Composition-based stats.
 Identities = 15/34 (44%), Positives = 21/34 (61%), Gaps = 3/34 (8%)

Query: 14  KRLGISPYASEEEIWGSRNFLLEQYTGHERSEES 47
           KRL  +P    E++   RN ++EQYT   R+EES
Sbjct: 370 KRLAENPEYENEKLTKLRNTIMEQYT---RTEES 400


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.138    0.427 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,573,384
Number of Sequences: 62578
Number of extensions: 203662
Number of successful extensions: 760
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 758
Number of HSP's gapped (non-prelim): 4
length of query: 201
length of database: 14,973,337
effective HSP length: 94
effective length of query: 107
effective length of database: 9,091,005
effective search space: 972737535
effective search space used: 972737535
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)