Citrus Sinensis ID: 028961


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MARGKVQMKRIENPVHRQVTFCKRRAGLLKKAKELSILCDADVGVFIFSNHGKLYELATNGTMQGLIEKYLKSTQGAQAEPVMQTQPLDAKDEINMLKQEIEILQKGLRYMFGGGTGTMTLDELLVLEKHLELWIYNIRSTKMDIMFQEINLLRNKEGILTAANKYLQDKMEENNGIANFGPITTNNIECPFAIPNEIFQF
ccccccHHHHccccccccccccccccccHHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHccccccccccccccccccccccc
*****VQMKRIENPVHRQVTFCKRRAGLLKKAKELSILCDADVGVFIFSNHGKLYELATNGTMQGLIEKYLK*******************DEINMLKQEIEILQKGLRYMFGGGTGTMTLDELLVLEKHLELWIYNIRSTKMDIMFQEINLLRNKEGILTAANKYLQDKMEENNGI************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARGKVQMKRIENPVHRQVTFCKRRAGLLKKAKELSILCDADVGVFIFSNHGKLYELATNGTMQGLIEKYLKSTQGAQAEPVMQTQPLDAKDEINMLKQEIEILQKGLRYMFGGGTGTMTLDELLVLEKHLELWIYNIRSTKMDIMFQEINLLRNKEGILTAANKYLQDKMEENNGIANFGPITTNNIECPFAIPNEIFQF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
MADS-box transcription factor 26 Probable transcription factor.probableQ0J8G8
Agamous-like MADS-box protein AGL12 Probable transcription factor.probableQ38841
MADS-box transcription factor 26 Probable transcription factor.probableA2YQK9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EGW, chain A
Confidence level:very confident
Coverage over the Query: 2-73
View the alignment between query and template
View the model in PyMOL
Template: 2JEE, chain A
Confidence level:probable
Coverage over the Query: 119-166
View the alignment between query and template
View the model in PyMOL