Citrus Sinensis ID: 028964


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-
MMKLSRSLLSSRSQLSEKLLAGEANYVRDGLKSHVLISQAGMSTTGHDVSAKGSLGGRIFAPYYVYKGKAAFSVDPVLPTFMKLDSGDLKVKRKGVILLTFAPAIGERKYDWAKKQHFALSPTEVGSLLTMGPRDSSEFFHDPAMLSSNAGQMRKSLSIKANADGFFISLNVANNILKTNERFVVPVSTAEFAVMKTACSV
cccccccccccHHHHHHHHccccccccccccccccEEECccccccccccccccccccCEECccEEECccEEEEEEEccccEEEcccccEEEEECcEEEEEEccccccccccccccEEEEEcHHHHHHHHccccccccEEEEcccccccccccccEEEEEEEcccccEEEEEEEEcccccccCEEEECcHHHHHHHHHHHcc
***************************RD**************************GGRIFAPYYVYKGKAAFSVDPVLPTFMKLDSGDLKVKRKGVILLTFAPAIGERKYDWAKKQHFALSPTEVGSLLTMGPRDSSEF*******************IKANADGFFISLNVANNILKTNERFVVPVSTAEFAVMKTACSV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKLSRSLLSSRSQLSEKLLAGEANYVRDGLKSHVLISQAGMSTTGHDVSAKGSLGGRIFAPYYVYKGKAAFSVDPVLPTFMKLDSGDLKVKRKGVILLTFAPAIGERKYDWAKKQHFALSPTEVGSLLTMGPRDSSEFFHDPAMLSSNAGQMRKSLSIKANADGFFISLNVANNILKTNERFVVPVSTAEFAVMKTACSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Single-stranded DNA-binding protein WHY2, mitochondrial Single-stranded DNA-binding protein that associates with mitochondrial DNA and may play a role in the regulation of the gene expression machinery. Seems also to be required to prevent break-induced DNA rearrangements in the mitochondrial genome. Can bind to melt double-stranded DNA in vivo.probableQ8VYF7
Single-stranded DNA-bindig protein WHY2, mitochondrial Single-stranded DNA-binding protein that may be involved in the maintenance of mitochondrial genome stability by preventing break-induced DNA rearrangements.probableD9J034

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3R9Z, chain A
Confidence level:very confident
Coverage over the Query: 55-201
View the alignment between query and template
View the model in PyMOL