Query         028968
Match_columns 201
No_of_seqs    139 out of 900
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 05:22:51 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028968.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028968hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG0335 RplS Ribosomal protein 100.0 1.3E-28 2.8E-33  195.1   8.4   70  132-201     7-77  (115)
  2 CHL00084 rpl19 ribosomal prote 100.0 2.8E-28   6E-33  193.5   9.9   75  125-201     4-79  (117)
  3 PRK05338 rplS 50S ribosomal pr  99.9 6.3E-28 1.4E-32  191.1   8.9   70  132-201     5-75  (116)
  4 TIGR01024 rplS_bact ribosomal   99.9 8.2E-28 1.8E-32  189.7   9.0   70  132-201     5-75  (113)
  5 PF01245 Ribosomal_L19:  Riboso  99.9 5.4E-27 1.2E-31  184.4  11.2   74  126-201     1-75  (113)
  6 KOG1698 Mitochondrial/chloropl  99.9 2.1E-23 4.5E-28  178.2  10.3  144   42-201     6-152 (201)
  7 PF05641 Agenet:  Agenet domain  85.2     2.8   6E-05   29.7   5.2   38  146-188     1-38  (68)
  8 smart00743 Agenet Tudor-like d  81.5       9  0.0002   25.9   6.4   49  144-200     1-49  (61)
  9 PF02211 NHase_beta:  Nitrile h  62.5     7.6 0.00016   34.2   3.0   36  142-177   131-170 (222)
 10 PF12969 DUF3857:  Domain of Un  61.9      15 0.00033   28.6   4.3   21  141-161    85-105 (177)
 11 TIGR03170 flgA_cterm flagella   60.3      33 0.00072   26.0   5.8   47  142-193    62-108 (122)
 12 PF02765 POT1:  Telomeric singl  58.9     8.9 0.00019   30.6   2.6   39  142-187    69-109 (146)
 13 cd00493 FabA_FabZ FabA/Z, beta  58.1      18  0.0004   26.6   4.0   30  145-174    88-117 (131)
 14 TIGR01750 fabZ beta-hydroxyacy  52.1      25 0.00054   27.0   4.0   28  145-172    97-124 (140)
 15 cd01288 FabZ FabZ is a 17kD be  52.1      49  0.0011   24.4   5.5   28  145-172    87-114 (131)
 16 PF13144 SAF_2:  SAF-like        49.3      61  0.0013   26.5   6.1   47  141-192   135-181 (196)
 17 smart00739 KOW KOW (Kyprides,   46.1      40 0.00086   19.0   3.3   27  145-177     1-27  (28)
 18 PF02752 Arrestin_C:  Arrestin   46.1      35 0.00076   24.9   3.9   31  145-175    15-46  (136)
 19 cd04497 hPOT1_OB1_like hPOT1_O  46.1      35 0.00075   27.1   4.1   41  141-188    64-104 (138)
 20 PRK00006 fabZ (3R)-hydroxymyri  44.4      34 0.00074   26.5   3.7   28  146-173   102-129 (147)
 21 PF07977 FabA:  FabA-like domai  42.5      27 0.00059   26.9   2.9   30  144-173    95-128 (138)
 22 COG1566 EmrA Multidrug resista  42.4      74  0.0016   29.9   6.2   63  134-199   247-318 (352)
 23 TIGR02266 gmx_TIGR02266 Myxoco  42.1      97  0.0021   22.0   5.6   35  144-179    35-69  (96)
 24 cd03451 FkbR2 FkbR2 is a Strep  41.4      43 0.00094   25.5   3.8   16  145-160    91-106 (146)
 25 cd04455 S1_NusA S1_NusA: N-uti  41.4      39 0.00085   23.3   3.3   22  145-166    40-62  (67)
 26 cd05690 S1_RPS1_repeat_ec5 S1_  41.3      29 0.00063   23.2   2.6   22  145-166    45-67  (69)
 27 PRK07018 flgA flagellar basal   40.3      87  0.0019   27.1   5.9   47  142-193   173-219 (235)
 28 cd00164 S1_like S1_like: Ribos  40.1      35 0.00075   21.5   2.7   16  145-160    41-56  (65)
 29 cd04471 S1_RNase_R S1_RNase_R:  40.1      29 0.00063   23.9   2.5   23  144-166    56-79  (83)
 30 PF00238 Ribosomal_L14:  Riboso  39.9      59  0.0013   26.0   4.5   36  142-177    29-67  (122)
 31 COG2030 MaoC Acyl dehydratase   39.7      41 0.00089   27.2   3.6   17  144-160   105-121 (159)
 32 cd05708 S1_Rrp5_repeat_sc12 S1  39.0      36 0.00078   23.0   2.8   21  145-165    47-68  (77)
 33 cd05703 S1_Rrp5_repeat_hs12_sc  38.0      40 0.00087   23.8   3.0   23  145-167    46-69  (73)
 34 cd03450 NodN NodN (nodulation   37.2      75  0.0016   25.6   4.8   33  146-178    98-134 (149)
 35 cd04452 S1_IF2_alpha S1_IF2_al  36.5      42 0.00092   22.8   2.8   15  146-160    50-64  (76)
 36 PF07238 PilZ:  PilZ domain;  I  36.1 1.1E+02  0.0024   20.8   5.0   32  145-178    44-75  (102)
 37 COG2139 RPL21A Ribosomal prote  35.9      40 0.00086   26.9   2.9   40  141-180    28-71  (98)
 38 cd05706 S1_Rrp5_repeat_sc10 S1  35.9      46   0.001   22.7   2.9   15  146-160    48-62  (73)
 39 cd04491 SoSSB_OBF SoSSB_OBF: A  35.8      49  0.0011   23.4   3.1   26  143-168    46-72  (82)
 40 cd05688 S1_RPS1_repeat_ec3 S1_  35.5      41  0.0009   22.0   2.6   15  146-160    45-59  (68)
 41 cd08544 Reeler Reeler, the N-t  35.5      86  0.0019   24.2   4.7   31  145-179    29-59  (135)
 42 cd05705 S1_Rrp5_repeat_hs14 S1  35.0      44 0.00095   23.8   2.8   22  145-166    50-72  (74)
 43 PF08207 EFP_N:  Elongation fac  35.0 1.4E+02   0.003   20.6   5.2   49  145-200     4-53  (58)
 44 PF09926 DUF2158:  Uncharacteri  34.6      26 0.00056   24.6   1.5   10  146-155     1-10  (53)
 45 PRK06005 flgA flagellar basal   34.4 1.1E+02  0.0024   25.3   5.5   48  142-194    97-144 (160)
 46 PRK04424 fatty acid biosynthes  34.4      64  0.0014   26.9   4.1   30  144-173   137-166 (185)
 47 PRK05483 rplN 50S ribosomal pr  34.4      70  0.0015   25.9   4.1   34  144-177    31-67  (122)
 48 cd06462 Peptidase_S24_S26 The   34.2      84  0.0018   21.2   4.0   43  143-193    11-53  (84)
 49 TIGR00405 L26e_arch ribosomal   34.1 1.7E+02  0.0037   23.0   6.3   43  144-194    85-127 (145)
 50 PRK08571 rpl14p 50S ribosomal   34.0 1.5E+02  0.0032   24.5   6.0   36  142-177    43-78  (132)
 51 cd03441 R_hydratase_like (R)-h  34.0 1.2E+02  0.0027   21.8   5.1   17  144-160    79-95  (127)
 52 cd05685 S1_Tex S1_Tex: The C-t  33.2      53  0.0012   21.3   2.8   20  146-165    45-65  (68)
 53 cd05686 S1_pNO40 S1_pNO40: pNO  32.1      55  0.0012   22.8   2.8   21  146-166    49-69  (73)
 54 TIGR00008 infA translation ini  31.5      34 0.00074   25.2   1.8   26  140-165    39-65  (68)
 55 cd05697 S1_Rrp5_repeat_hs5 S1_  30.7      63  0.0014   21.9   2.9   22  145-166    44-66  (69)
 56 PRK15136 multidrug efflux syst  30.7      91   0.002   28.7   4.8   33  141-176   261-293 (390)
 57 PRK02268 hypothetical protein;  30.6      64  0.0014   26.8   3.4   36  141-176    31-68  (141)
 58 PRK03999 translation initiatio  30.4 1.2E+02  0.0026   24.4   4.8   54  142-200     7-60  (129)
 59 PRK06461 single-stranded DNA-b  30.2      55  0.0012   25.9   2.9   28  143-170    62-90  (129)
 60 TIGR01067 rplN_bact ribosomal   30.2      97  0.0021   25.0   4.3   34  144-177    31-67  (122)
 61 PF00717 Peptidase_S24:  Peptid  30.0      42 0.00091   22.4   1.9   40  143-190     8-47  (70)
 62 cd05698 S1_Rrp5_repeat_hs6_sc5  29.9      67  0.0015   21.6   2.9   15  146-160    45-59  (70)
 63 PRK08559 nusG transcription an  29.8 2.3E+02   0.005   23.0   6.5   41  144-192    93-133 (153)
 64 cd05689 S1_RPS1_repeat_ec4 S1_  29.3      60  0.0013   22.0   2.6   21  145-165    48-69  (72)
 65 PF13437 HlyD_3:  HlyD family s  29.1 1.7E+02  0.0037   21.0   5.2   44  140-187    44-90  (105)
 66 cd05704 S1_Rrp5_repeat_hs13 S1  29.0      67  0.0014   22.5   2.9   22  144-166    47-68  (72)
 67 PF10447 EXOSC1:  Exosome compo  28.7      40 0.00087   25.4   1.8   14  143-156    66-79  (82)
 68 cd05707 S1_Rrp5_repeat_sc11 S1  28.6      69  0.0015   21.6   2.8   21  145-165    44-65  (68)
 69 PTZ00054 60S ribosomal protein  28.5 1.2E+02  0.0026   25.3   4.7   35  142-176    50-84  (139)
 70 TIGR03673 rpl14p_arch 50S ribo  28.4   2E+02  0.0044   23.7   5.9   36  142-177    42-77  (131)
 71 PF04319 NifZ:  NifZ domain;  I  28.4      69  0.0015   24.2   3.0   34  144-177     3-36  (75)
 72 smart00316 S1 Ribosomal protei  28.3      72  0.0016   20.3   2.8   16  145-160    46-61  (72)
 73 TIGR01956 NusG_myco NusG famil  28.1   1E+02  0.0022   28.1   4.5   30  142-177   202-231 (258)
 74 PF02014 Reeler:  Reeler domain  28.0      61  0.0013   25.1   2.8   33  144-180    28-60  (132)
 75 PF11302 DUF3104:  Protein of u  27.3 2.1E+02  0.0046   21.7   5.4   51  143-193     3-58  (75)
 76 PF00575 S1:  S1 RNA binding do  27.2      69  0.0015   21.7   2.6   25  142-166    45-70  (74)
 77 PF03061 4HBT:  Thioesterase su  27.2   1E+02  0.0022   20.3   3.4   28  145-172    43-70  (79)
 78 cd03452 MaoC_C MaoC_C  The C-t  27.1      93   0.002   24.3   3.7   15  146-160    89-103 (142)
 79 PF11717 Tudor-knot:  RNA bindi  27.1   2E+02  0.0044   19.4   5.0   36  146-187     1-36  (55)
 80 cd03440 hot_dog The hotdog fol  26.8 1.6E+02  0.0034   17.9   4.3   21  144-164    56-76  (100)
 81 PRK12617 flgA flagellar basal   26.7 1.9E+02  0.0042   25.2   5.9   47  144-195   154-200 (214)
 82 PRK08515 flgA flagellar basal   26.6 1.8E+02  0.0039   25.2   5.6   47  141-193   161-207 (222)
 83 PRK12618 flgA flagellar basal   26.4 1.8E+02  0.0038   23.7   5.2   47  143-194    79-125 (141)
 84 cd01289 FabA_like Domain of un  26.2      91   0.002   24.5   3.5   30  144-173    91-121 (138)
 85 cd03447 FAS_MaoC FAS_MaoC, the  26.2 1.2E+02  0.0026   23.5   4.1   16  145-160    80-95  (126)
 86 TIGR02754 sod_Ni_protease nick  26.0 1.6E+02  0.0035   21.0   4.5   13  143-155     9-21  (90)
 87 cd04461 S1_Rrp5_repeat_hs8_sc7  26.0      84  0.0018   22.2   3.0   21  145-165    58-79  (83)
 88 TIGR01000 bacteriocin_acc bact  25.9 1.3E+02  0.0029   28.1   5.0   46  140-187   366-415 (457)
 89 cd05691 S1_RPS1_repeat_ec6 S1_  25.9      86  0.0019   20.9   2.9   16  145-160    44-59  (73)
 90 cd03449 R_hydratase (R)-hydrat  25.9 1.6E+02  0.0035   21.4   4.6   16  145-160    82-97  (128)
 91 PRK13692 (3R)-hydroxyacyl-ACP   25.8 1.3E+02  0.0029   24.4   4.5   16  145-160    96-111 (159)
 92 TIGR00074 hypC_hupF hydrogenas  25.7      51  0.0011   24.6   1.9   15  143-157    33-47  (76)
 93 PF01575 MaoC_dehydratas:  MaoC  25.6      75  0.0016   23.9   2.8   28  144-171    87-114 (122)
 94 KOG0494 Transcription factor C  25.3      14  0.0003   34.5  -1.5   68   99-168   120-188 (332)
 95 PRK09014 rfaH transcriptional   25.2      83  0.0018   25.2   3.1   27  145-177   109-135 (162)
 96 PF08605 Rad9_Rad53_bind:  Fung  24.8      38 0.00083   27.7   1.1   14  143-156    57-70  (131)
 97 PF12148 DUF3590:  Protein of u  24.5      44 0.00096   25.8   1.3   22  143-164    63-84  (85)
 98 TIGR01955 RfaH transcriptional  24.2 1.1E+02  0.0024   24.1   3.6   29  144-178   107-135 (159)
 99 COG1499 NMD3 NMD protein affec  24.0      46 0.00099   31.4   1.6   15  142-156   243-257 (355)
100 PF11325 DUF3127:  Domain of un  23.9      73  0.0016   24.4   2.4   18  143-160    50-67  (84)
101 COG0361 InfA Translation initi  23.8      58  0.0013   24.6   1.8   27  139-165    40-67  (75)
102 cd04486 YhcR_OBF_like YhcR_OBF  23.7      95  0.0021   22.7   2.9   24  143-166    42-65  (78)
103 cd05696 S1_Rrp5_repeat_hs4 S1_  23.5      99  0.0021   21.5   2.9   21  145-165    46-67  (71)
104 PF14326 DUF4384:  Domain of un  23.3      78  0.0017   22.9   2.4   17  144-160     1-17  (83)
105 cd05687 S1_RPS1_repeat_ec1_hs1  23.3 1.1E+02  0.0023   20.7   2.9   15  146-160    45-59  (70)
106 smart00276 GLECT Galectin. Gal  23.0 1.1E+02  0.0024   23.6   3.3   50  141-190     3-57  (128)
107 PRK12442 translation initiatio  23.0      60  0.0013   25.3   1.8   24  139-162    40-64  (87)
108 PF04225 OapA:  Opacity-associa  22.5 1.1E+02  0.0023   22.9   3.0   19  139-157    36-54  (85)
109 KOG3416 Predicted nucleic acid  22.3   1E+02  0.0022   25.8   3.1   29  145-179    61-89  (134)
110 cd00070 GLECT Galectin/galacto  22.2 1.2E+02  0.0025   23.3   3.3   25  141-165     4-29  (127)
111 PF01052 SpoA:  Surface present  21.9      66  0.0014   22.6   1.8   35  143-177    26-64  (77)
112 PRK10800 acyl-CoA thioesterase  21.9 1.6E+02  0.0035   22.0   4.0   27  144-170    65-92  (130)
113 cd05692 S1_RPS1_repeat_hs4 S1_  21.6 1.3E+02  0.0028   19.4   3.1   13  145-157    44-56  (69)
114 PRK06804 flgA flagellar basal   21.3 2.2E+02  0.0047   25.7   5.3   47  143-194   200-246 (261)
115 cd03446 MaoC_like MoaC_like     21.3 1.5E+02  0.0034   22.2   3.8   16  145-160    90-105 (140)
116 TIGR02799 thio_ybgC tol-pal sy  21.2 1.7E+02  0.0038   21.3   4.0   28  145-172    65-93  (126)
117 cd05693 S1_Rrp5_repeat_hs1_sc1  20.7 1.1E+02  0.0023   23.3   2.8   16  145-160    66-81  (100)
118 PRK13691 (3R)-hydroxyacyl-ACP   20.6 1.3E+02  0.0028   24.8   3.4   16  145-160    96-111 (166)
119 cd03455 SAV4209 SAV4209 is a S  20.6 1.9E+02   0.004   21.7   4.1   16  145-160    79-94  (123)
120 CHL00057 rpl14 ribosomal prote  20.6 1.9E+02  0.0041   23.4   4.3   34  144-177    31-67  (122)
121 PRK11281 hypothetical protein;  20.5 2.1E+02  0.0045   31.1   5.7   36  145-180   938-979 (1113)
122 PF01455 HupF_HypC:  HupF/HypC   20.5      77  0.0017   23.0   1.9   14  143-156    35-48  (68)
123 TIGR00922 nusG transcription t  20.4 4.5E+02  0.0098   21.0   7.4   28  144-177   118-145 (172)
124 COG5496 Predicted thioesterase  20.4 2.5E+02  0.0054   23.4   5.0   47  143-190    68-114 (130)
125 PF01281 Ribosomal_L9_N:  Ribos  20.3      76  0.0017   21.8   1.7   17  139-155     5-22  (48)
126 PRK12786 flgA flagellar basal   20.3 2.6E+02  0.0056   26.0   5.7   47  143-194   256-302 (338)
127 PRK08572 rps17p 30S ribosomal   20.0 1.2E+02  0.0025   24.4   3.0   22  164-188    28-49  (108)
128 PF01336 tRNA_anti-codon:  OB-f  20.0 1.3E+02  0.0028   19.9   2.8   19  145-163    44-62  (75)

No 1  
>COG0335 RplS Ribosomal protein L19 [Translation, ribosomal structure and biogenesis]
Probab=99.95  E-value=1.3e-28  Score=195.13  Aligned_cols=70  Identities=36%  Similarity=0.763  Sum_probs=67.2

Q ss_pred             HHHHhhhcCCCCCCCCCCCEEEEEEEeec-CCcccceEEEEEEEeecCCccceEEEEeeeCCeeeEEEeeC
Q 028968          132 RAVEASESERPIPDIRTGDVVEIKLEVPE-NRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPL  201 (201)
Q Consensus       132 e~IE~~q~kkdiPeFr~GDtVrV~v~I~E-nKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGVER~FPL  201 (201)
                      +++++.|+++++|+|+|||||+|+++|.| +|+|+|.|+|+||+++|+|+++||||||+++|+||||+||+
T Consensus         7 ~~le~~q~~~~iP~f~~GDtvrv~vki~Eg~keR~Q~FeGvVia~r~~G~~~tftvRkis~G~GVEr~Fp~   77 (115)
T COG0335           7 QQLEQEQIKKDIPSFRPGDTVRVHVKIVEGSKERVQAFEGVVIARRGRGISETFTVRKISYGVGVERVFPL   77 (115)
T ss_pred             HHHHHHHHHhhCCCCCCCCEEEEEEEEEeCCeEEEeeeeEEEEEECCCCccceEEEEEeecCceEEEEeec
Confidence            56788888889999999999999999999 99999999999999999999999999999999999999996


No 2  
>CHL00084 rpl19 ribosomal protein L19
Probab=99.95  E-value=2.8e-28  Score=193.45  Aligned_cols=75  Identities=36%  Similarity=0.753  Sum_probs=69.9

Q ss_pred             HHHHHHHHHHHhhhcCCCCCCCCCCCEEEEEEEeec-CCcccceEEEEEEEeecCCccceEEEEeeeCCeeeEEEeeC
Q 028968          125 IMGILNKRAVEASESERPIPDIRTGDVVEIKLEVPE-NRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPL  201 (201)
Q Consensus       125 lM~iLnke~IE~~q~kkdiPeFr~GDtVrV~v~I~E-nKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGVER~FPL  201 (201)
                      +++++  +++++.++++++|+|++||||+|+++|.| +|+|+|.|+|+||+++|+|+++||||||+++|+||||+|||
T Consensus         4 ~~~~i--~~~~~~~~~~~~p~f~~GDtV~V~~~i~eg~k~R~q~F~GvvI~~r~~G~~~tftvRki~~gvGVEr~fpl   79 (117)
T CHL00084          4 LQQLV--KEIESEFLKKNLPKIRVGDTVKVGVLIQEGNKERVQFYEGTVIAKKNSGLNTTITVRKVFQGIGVERVFLL   79 (117)
T ss_pred             HHHHH--HHHHHHHhhcCCCccCCCCEEEEEEEEecCCeeEeceEEEEEEEEeCCCCCeeEEEEEeccCccEEEEEec
Confidence            34455  56888888999999999999999999999 99999999999999999999999999999999999999996


No 3  
>PRK05338 rplS 50S ribosomal protein L19; Provisional
Probab=99.95  E-value=6.3e-28  Score=191.07  Aligned_cols=70  Identities=37%  Similarity=0.798  Sum_probs=66.4

Q ss_pred             HHHHhhhcCCCCCCCCCCCEEEEEEEeec-CCcccceEEEEEEEeecCCccceEEEEeeeCCeeeEEEeeC
Q 028968          132 RAVEASESERPIPDIRTGDVVEIKLEVPE-NRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPL  201 (201)
Q Consensus       132 e~IE~~q~kkdiPeFr~GDtVrV~v~I~E-nKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGVER~FPL  201 (201)
                      +.+|+.++++++|+|++||||+|+++|.| +|+|+|.|+|+||+++|+|+++||||||+++|+||||+|||
T Consensus         5 ~~~~~~~~~~~~p~f~~GD~V~V~~~i~eg~k~R~q~f~GvvI~~~~~G~~~tftvRki~~gvGVEr~fpl   75 (116)
T PRK05338          5 KEIEAEQLRKDIPEFRPGDTVRVHVKVVEGNKERIQAFEGVVIARRGRGLNETFTVRKISYGVGVERTFPL   75 (116)
T ss_pred             HHHHHHHhhcCCCCcCCCCEEEEEEEEccCCceEeccEEEEEEEEeCCCCCceEEEEEcccCccEEEEecC
Confidence            45677777889999999999999999999 89999999999999999999999999999999999999997


No 4  
>TIGR01024 rplS_bact ribosomal protein L19, bacterial type. This model describes bacterial ribosomoal protein L19 and its chloroplast equivalent. Putative mitochondrial L19 are found in several species (but not Saccharomyces cerevisiae) and score between trusted and noise cutoffs.
Probab=99.95  E-value=8.2e-28  Score=189.70  Aligned_cols=70  Identities=34%  Similarity=0.808  Sum_probs=66.6

Q ss_pred             HHHHhhhcCCCCCCCCCCCEEEEEEEeec-CCcccceEEEEEEEeecCCccceEEEEeeeCCeeeEEEeeC
Q 028968          132 RAVEASESERPIPDIRTGDVVEIKLEVPE-NRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPL  201 (201)
Q Consensus       132 e~IE~~q~kkdiPeFr~GDtVrV~v~I~E-nKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGVER~FPL  201 (201)
                      +.+|+.++++++|+|++||||+|+++|.| +|+|+|.|+|+||+++|+|+++||||||+++|+||||+|||
T Consensus         5 ~~~e~~~~~~~ip~f~~GD~v~V~~~i~eg~k~R~q~f~GvvI~~~~~G~~~tftvR~i~~gvGVEr~fpl   75 (113)
T TIGR01024         5 KQIEQEQLKKDLPDFRVGDTVRVHVKIVEGKKERIQVFEGVVIARRGGGIGETFTVRKISYGVGVERIFPL   75 (113)
T ss_pred             HHHHHHHhhcCCCccCCCCEEEEEEEEccCCceEcccEEEEEEEEeCCCCceEEEEEEeccCccEEEEEEc
Confidence            45677778899999999999999999999 99999999999999999999999999999999999999997


No 5  
>PF01245 Ribosomal_L19:  Ribosomal protein L19;  InterPro: IPR001857 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L19 is one of the proteins from the large ribosomal subunit [, ]. In Escherichia coli, L19 is known to be located at the 30S-50S ribosomal subunit interface [] and may play a role in the structure and function of the aminoacyl-tRNA binding site. It belongs to a family of ribosomal proteins, including L19 from bacteria and the chloroplasts of red algae. L19 is a protein of 120 to 130 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3HUZ_T 3V2D_T 3I8I_R 2XG2_T 2V49_T 2XUX_T 3HUX_T 3I9C_R 3V25_T 3UZ2_R ....
Probab=99.94  E-value=5.4e-27  Score=184.38  Aligned_cols=74  Identities=35%  Similarity=0.814  Sum_probs=70.1

Q ss_pred             HHHHHHHHHHhhhcCCCCCCCCCCCEEEEEEEeec-CCcccceEEEEEEEeecCCccceEEEEeeeCCeeeEEEeeC
Q 028968          126 MGILNKRAVEASESERPIPDIRTGDVVEIKLEVPE-NRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFPL  201 (201)
Q Consensus       126 M~iLnke~IE~~q~kkdiPeFr~GDtVrV~v~I~E-nKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGVER~FPL  201 (201)
                      |++|  +++|+.++++++|+|++||+|+|++++.| +|+|+|.|+|+||+++|+|+++||||||+++|+||||+|||
T Consensus         1 ~~~i--~~~e~~~~~~~~p~f~~GD~v~V~~~i~e~~k~r~q~f~GvvIa~~~~g~~ssftlR~~~~g~gVE~~f~l   75 (113)
T PF01245_consen    1 MNLI--EEVEREQIKKDIPEFRVGDTVRVTYKISEGNKERIQVFEGVVIARRRRGLNSSFTLRNISQGVGVERVFPL   75 (113)
T ss_dssp             -HHH--HHHHHTTCSSSSSSSSSSSEEEEEEEEESSSSEEEEEEEEEEEEEEBSSTSSEEEEEEEETTEEEEEEEET
T ss_pred             ChHH--HHHHHHHhhcCCCCcCCCCEEEEEEEEecCCCceeEEEEEEEEEEECCCCCeeEEEEEEecCccEEEEEEc
Confidence            6666  67889989999999999999999999999 99999999999999999999999999999999999999997


No 6  
>KOG1698 consensus Mitochondrial/chloroplast ribosomal protein L19 [Translation, ribosomal structure and biogenesis]
Probab=99.89  E-value=2.1e-23  Score=178.20  Aligned_cols=144  Identities=31%  Similarity=0.450  Sum_probs=112.7

Q ss_pred             eeeeec---CCCccccceeeccccceeEEeeccchhhhcchhhHHHhHHHHhhccceeeeecccccccchhhhccCCCCC
Q 028968           42 VSVSAK---PIGWNLGFFVNAQVKDSFVVRAEANEEAEANESIEEEQNEAVQAQGDVVVAVEAESEDKVEEEEVKAPRKP  118 (201)
Q Consensus        42 ~~~~~~---~~~~~~~~~~~~~~~~~~v~~a~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~e~~~~~~~e~~~~~p~r~~  118 (201)
                      +++++.   +..|++.+.+.....++|+..+|.-..+.....+                ..++.-+...-.....+..+.
T Consensus         6 ~~~~r~~~~~~a~~~~v~l~~~~~~~~~~~~e~~~~a~~~~~~----------------~~~~~~~~~~~~~~~~~f~~~   69 (201)
T KOG1698|consen    6 LGFDRFPMFRAASYRNVSLKGKWFSSFIAISEERCFAPTKRPS----------------VNEPSPESPCVVEQYPEFLPL   69 (201)
T ss_pred             eeeecccccchhhhheeecccceeeeeccccccccccCCCCcc----------------cccCCCCCccccccCcccccc
Confidence            444444   3566777777778888999888764333322220                123322222222344556667


Q ss_pred             CCchhHHHHHHHHHHHHhhhcCCCCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCeeeEEE
Q 028968          119 RVKLGDIMGILNKRAVEASESERPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIV  198 (201)
Q Consensus       119 ~~klg~lM~iLnke~IE~~q~kkdiPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGVER~  198 (201)
                      ++..+++|++|++++++...+.+++|+|++||+|+|++..+++|.++..|.||||+|+|.|+++||+|||++.|+|||.+
T Consensus        70 ~~~~~~~~e~Ldr~a~~~rr~~r~iPe~~~G~Iv~V~s~~p~~k~k~s~f~Gi~I~R~~~Gl~atf~LRnvIagvGVEi~  149 (201)
T KOG1698|consen   70 RKVAKRIMEILDRQAVLERRKVRDIPEFKVGSIVRVTSEDPENKRKVSRFKGICIRRRNAGLNATFLLRNVIAGVGVEIV  149 (201)
T ss_pred             hhHHHHHHHhhCHHHHHHHHhcccCCccccccEEEEEecCCccCCceeEEEEEEEEecccCCcceEEeeehhhCceeEEE
Confidence            77789999999999999998889999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeC
Q 028968          199 FPL  201 (201)
Q Consensus       199 FPL  201 (201)
                      |||
T Consensus       150 ~pL  152 (201)
T KOG1698|consen  150 FPL  152 (201)
T ss_pred             Eec
Confidence            997


No 7  
>PF05641 Agenet:  Agenet domain;  InterPro: IPR008395 This domain is related to the TUDOR domain IPR008191 from INTERPRO []. The function of the agenet domain is unknown. This signature matches one of the two Agenet domains in the FMR proteins [].; GO: 0003723 RNA binding; PDB: 2BKD_N 3O8V_A 3KUF_A 3H8Z_A.
Probab=85.18  E-value=2.8  Score=29.69  Aligned_cols=38  Identities=18%  Similarity=0.318  Sum_probs=26.0

Q ss_pred             CCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEe
Q 028968          146 IRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRR  188 (201)
Q Consensus       146 Fr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRK  188 (201)
                      |++||.|+|...  |+.-|-.=|.|+|++..+.+   +|.|+-
T Consensus         1 F~~G~~VEV~s~--e~g~~gaWf~a~V~~~~~~~---~~~V~Y   38 (68)
T PF05641_consen    1 FKKGDEVEVSSD--EDGFRGAWFPATVLKENGDD---KYLVEY   38 (68)
T ss_dssp             --TT-EEEEEE---SBTT--EEEEEEEEEEETT----EEEEEE
T ss_pred             CCCCCEEEEEEc--CCCCCcEEEEEEEEEeCCCc---EEEEEE
Confidence            789999999753  34459999999999999876   788875


No 8  
>smart00743 Agenet Tudor-like domain present in plant sequences. Domain in plant sequences with possible chromatin-associated functions.
Probab=81.46  E-value=9  Score=25.88  Aligned_cols=49  Identities=16%  Similarity=0.193  Sum_probs=35.7

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCeeeEEEee
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFP  200 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGVER~FP  200 (201)
                      ..|++||.|.+....     .-.=|.|+|++..+   +..|.|+=...+.|-+-+|+
T Consensus         1 ~~~~~G~~Ve~~~~~-----~~~W~~a~V~~~~~---~~~~~V~~~~~~~~~~e~v~   49 (61)
T smart00743        1 SDFKKGDRVEVFSKE-----EDSWWEAVVTKVLG---DGKYLVRYLTESEPLKETVD   49 (61)
T ss_pred             CCcCCCCEEEEEECC-----CCEEEEEEEEEECC---CCEEEEEECCCCcccEEEEe
Confidence            368999999998752     56789999999887   45688887654466554443


No 9  
>PF02211 NHase_beta:  Nitrile hydratase beta subunit;  InterPro: IPR024690 Nitrile hydratases (EC:4.2.1.84) are unusual metalloenzymes that catalyse the hydration of nitriles to their corresponding amides. They are used as biocatalysts in acrylamide production, one of the few commercial scale bioprocesses, as well as in environmental remediation for the removal of nitriles from waste streams. Nitrile hydratases are composed of two subunits, alpha and beta, and they contain one iron atom per alpha beta unit []. This entry represents the structural domain of nitrile hydratase beta subunit which contains irregular array of helices in the N-terminal extension.; GO: 0018822 nitrile hydratase activity; PDB: 2DXB_H 2DD5_K 2DD4_H 2ZZD_B 2DXC_H 1AHJ_F 2ZPE_B 2ZCF_B 2D0Q_B 2CZ7_B ....
Probab=62.47  E-value=7.6  Score=34.18  Aligned_cols=36  Identities=25%  Similarity=0.424  Sum_probs=20.6

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceE----EEEEEEeec
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIY----KGIVMSRQN  177 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~F----eGIVIarrn  177 (201)
                      .-|.|++||.|+|.-.-+..-.|+..|    .|+|.+.+|
T Consensus       131 ~~~~F~vGd~Vrv~~~~~~~HtR~P~Y~rg~~G~I~~~~g  170 (222)
T PF02211_consen  131 APPRFAVGDRVRVRNLPPPGHTRLPRYVRGKTGTIERVHG  170 (222)
T ss_dssp             SS-SS-TT-EEEE-----SS--SS-GGGTT-EEEEEEEEE
T ss_pred             CCCCCCCCCEEEECCCCCCCcccccHhhCCCeeEEEEEec
Confidence            468999999999997766678888887    788887665


No 10 
>PF12969 DUF3857:  Domain of Unknown Function with PDB structure (DUF3857);  InterPro: IPR024618 This domain is based on the first domain of the PDB structure 3KD4 (residues 1-228). It is structurally similar to domains in other hydrolases, eg. M1 family aminopeptidase, despite lack of any significant sequence similarity. The domain is N-terminal to a transglutaminase domain, which is found in many proteins known to have transglutaminase activity. The function of this domain is unknown. ; PDB: 3KD4_A.
Probab=61.90  E-value=15  Score=28.64  Aligned_cols=21  Identities=29%  Similarity=0.668  Sum_probs=13.5

Q ss_pred             CCCCCCCCCCEEEEEEEeecC
Q 028968          141 RPIPDIRTGDVVEIKLEVPEN  161 (201)
Q Consensus       141 kdiPeFr~GDtVrV~v~I~En  161 (201)
                      -.+|++++||+|...+.+...
T Consensus        85 ~~~p~v~~GdiIe~~y~~~~~  105 (177)
T PF12969_consen   85 FAFPDVRVGDIIEYSYTIKSK  105 (177)
T ss_dssp             EE--S--TT-EEEEEEEEEE-
T ss_pred             EEcCCCCCCcEEEEEEEEEec
Confidence            479999999999999999763


No 11 
>TIGR03170 flgA_cterm flagella basal body P-ring formation protein FlgA. This model describes a conserved C-terminal region of the flagellar basal body P-ring formation protein FlgA. This sequence region contains a SAF domain, now described by Pfam model pfam08666.
Probab=60.30  E-value=33  Score=26.04  Aligned_cols=47  Identities=21%  Similarity=0.259  Sum_probs=34.5

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCe
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGI  193 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GV  193 (201)
                      ..|-++-||+|.|.+...-    ++ .+-...|..+++++.++.|||...|-
T Consensus        62 ~~~~V~~G~~V~i~~~~~~----~~-i~~~g~Al~~g~~G~~I~V~N~~s~k  108 (122)
T TIGR03170        62 PPWLVKRGDTVTVIARGGG----LS-VTTEGKALEDGAVGDQIRVRNLSSGK  108 (122)
T ss_pred             CccEEcCCCEEEEEEecCC----EE-EEEEEEEccccCCCCEEEEEECCCCC
Confidence            4578999999999886431    11 22345788899999999999976653


No 12 
>PF02765 POT1:  Telomeric single stranded DNA binding POT1/CDC13;  InterPro: IPR011564  This entry represents a domain that binds single stranded telomeric DNA and adopts an OB fold []. It includes the proteins POT1 and CDC13 which have been shown to regulate telomere length, replication and capping [, , ]. ; GO: 0003677 DNA binding, 0000723 telomere maintenance, 0000784 nuclear chromosome, telomeric region; PDB: 1S40_A 1KXL_A 1PH7_A 1PH9_A 1PH2_A 1OTC_A 1PHJ_A 1JB7_A 1PA6_A 1PH1_A ....
Probab=58.89  E-value=8.9  Score=30.60  Aligned_cols=39  Identities=15%  Similarity=0.508  Sum_probs=26.6

Q ss_pred             CCCCCCC-CCEEEEE-EEeecCCcccceEEEEEEEeecCCccceEEEE
Q 028968          142 PIPDIRT-GDVVEIK-LEVPENRRRLSIYKGIVMSRQNAGIHTTIRIR  187 (201)
Q Consensus       142 diPeFr~-GDtVrV~-v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVR  187 (201)
                      .+|.+.. ||+|.++ ++       +|.|.|-..+..+.+-+++|-|=
T Consensus        69 ~LP~v~~~GDii~l~r~k-------v~~~~~~~~~~~~~~~~ss~~vf  109 (146)
T PF02765_consen   69 SLPNVKSVGDIIRLRRVK-------VQSYNGKPQGLSNSTSNSSWAVF  109 (146)
T ss_dssp             HSCTTCSTTHEEEEEEEE-------EEEETTEEEEEEECECTEEEEEE
T ss_pred             HCCCCCCCCCEEEEEEEE-------EEEECCEEEEEecCCCcEEEEEE
Confidence            5799998 9999998 55       45555555555555555666665


No 13 
>cd00493 FabA_FabZ FabA/Z, beta-hydroxyacyl-acyl carrier protein (ACP)-dehydratases: One of several distinct enzyme types of the dissociative, type II, fatty acid synthase system (found in bacteria and plants) required to complete successive cycles of fatty acid elongation. The third step of the elongation cycle, the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, is catalyzed by FabA or FabZ.  FabA is bifunctional and catalyzes an additional isomerization reaction of trans-2-acyl-ACP to cis-3-acyl-ACP, an essential reaction to unsaturated fatty acid synthesis.  FabZ is the primary dehydratase that participates in the elongation cycles of saturated as well as unsaturated fatty acid biosynthesis, whereas FabA is more active in the dehydration of beta-hydroxydecanoyl-ACP. The FabA structure is homodimeric with two independent active sites located at the dimer interface.
Probab=58.14  E-value=18  Score=26.58  Aligned_cols=30  Identities=23%  Similarity=0.452  Sum_probs=24.0

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEEEE
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIVMS  174 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIVIa  174 (201)
                      ..+|||++.+.+++.+.+.++-.|.+.+..
T Consensus        88 ~v~pgd~l~i~~~i~~~~~~~~~~~~~~~~  117 (131)
T cd00493          88 PVLPGDTLTLEVELLKVRRGLGKFDGRAYV  117 (131)
T ss_pred             CcCCCCEEEEEEEEEEeeCCEEEEEEEEEE
Confidence            467999999999999865677777777654


No 14 
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ. This enzyme, FabZ, shows overlapping substrate specificity with FabA with regard to chain length in fatty acid biosynthesis. FabZ works preferentially on shorter chains and is often designated (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase, although its actual specificity is broader. Unlike FabA, FabZ does not function as an isomerase and cannot initiate unsaturated fatty acid biosynthesis. However, only FabZ can act during the elongation of unsaturated fatty acid chains.
Probab=52.08  E-value=25  Score=26.98  Aligned_cols=28  Identities=25%  Similarity=0.483  Sum_probs=21.8

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEE
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIV  172 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIV  172 (201)
                      ..+|||++.+++++.+...+.-.|.|.+
T Consensus        97 ~v~pGd~l~i~~~i~~~~~~~~~~~~~~  124 (140)
T TIGR01750        97 PVVPGDQLILHAEFLKKRRKIGKFKGEA  124 (140)
T ss_pred             ccCCCCEEEEEEEEEEccCCEEEEEEEE
Confidence            3678999999999988556666777765


No 15 
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway.
Probab=52.07  E-value=49  Score=24.42  Aligned_cols=28  Identities=25%  Similarity=0.464  Sum_probs=22.6

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEE
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIV  172 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIV  172 (201)
                      ...|||++++.+++.+.+.+.-.|++.+
T Consensus        87 pv~pgd~l~i~~~v~~~~~~~~~~~~~~  114 (131)
T cd01288          87 PVVPGDQLILEVELLKLRRGIGKFKGKA  114 (131)
T ss_pred             ccCCCCEEEEEEEEEEeeCCEEEEEEEE
Confidence            3568999999999998666777777776


No 16 
>PF13144 SAF_2:  SAF-like
Probab=49.25  E-value=61  Score=26.55  Aligned_cols=47  Identities=21%  Similarity=0.400  Sum_probs=34.9

Q ss_pred             CCCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCC
Q 028968          141 RPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAG  192 (201)
Q Consensus       141 kdiPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~G  192 (201)
                      +..|-++-||.|.|.+...-    ++ .+-..+|..++.++.+++|||...|
T Consensus       135 ~~~~~V~~G~~V~v~~~~g~----i~-i~~~g~Al~~G~~G~~I~V~N~~S~  181 (196)
T PF13144_consen  135 EPPPLVKRGDIVTVIARSGG----IS-ISTEGKALEDGALGDTIRVKNLSSG  181 (196)
T ss_pred             ccceecCCCCEEEEEEEeCC----EE-EEEEEEEccCCCCCCEEEEEECCCC
Confidence            34588999999999876431    22 2234578889999999999997655


No 17 
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif in ribosomal proteins, NusG, Spt5p, KIN17 and T54.
Probab=46.13  E-value=40  Score=19.04  Aligned_cols=27  Identities=19%  Similarity=0.235  Sum_probs=18.0

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn  177 (201)
                      .|.+||.|+|.-      -...-+.|+++...+
T Consensus         1 ~~~~G~~V~I~~------G~~~g~~g~i~~i~~   27 (28)
T smart00739        1 KFEVGDTVRVIA------GPFKGKVGKVLEVDG   27 (28)
T ss_pred             CCCCCCEEEEeE------CCCCCcEEEEEEEcC
Confidence            378999999863      334445777776643


No 18 
>PF02752 Arrestin_C:  Arrestin (or S-antigen), C-terminal domain;  InterPro: IPR011022 G protein-coupled receptors are a large family of signalling molecules that respond to a wide variety of extracellular stimuli. The receptors relay the information encoded by the ligand through the activation of heterotrimeric G proteins and intracellular effector molecules. To ensure the appropriate regulation of the signalling cascade, it is vital to properly inactivate the receptor. This inactivation is achieved, in part, by the binding of a soluble protein, arrestin, which uncouples the receptor from the downstream G protein after the receptors are phosphorylated by G protein-coupled receptor kinases. In addition to the inactivation of G protein-coupled receptors, arrestins have also been implicated in the endocytosis of receptors and cross talk with other signalling pathways. Arrestin (retinal S-antigen) is a major protein of the retinal rod outer segments. It interacts with photo-activated phosphorylated rhodopsin, inhibiting or 'arresting' its ability to interact with transducin []. The protein binds calcium, and shows similarity in its C terminus to alpha-transducin and other purine nucleotide-binding proteins. In mammals, arrestin is associated with autoimmune uveitis. Arrestins comprise a family of closely-related proteins that includes beta-arrestin-1 and -2, which regulate the function of beta-adrenergic receptors by binding to their phosphorylated forms, impairing their capacity to activate G(S) proteins; Cone photoreceptors C-arrestin (arrestin-X) [], which could bind to phosphorylated red/green opsins; and Drosophila phosrestins I and II, which undergo light-induced phosphorylation, and probably play a role in photoreceptor transduction [, , ].  The crystal structure of bovine retinal arrestin comprises two domains of antiparallel beta-sheets connected through a hinge region and one short alpha-helix on the back of the amino-terminal fold []. The binding region for phosphorylated light-activated rhodopsin is located at the N-terminal domain, as indicated by the docking of the photoreceptor to the three-dimensional structure of arrestin.  The C-terminal domain consists of an immunoglobulin-like beta-sandwich structure. This entry represents proteins with immunoglobulin-like domains that are similar to those found in arrestin.; PDB: 1SUJ_A 3UGX_A 1CF1_B 1AYR_A 3UGU_A 3P2D_B 1ZSH_A 2WTR_B 3GC3_A 1G4R_A ....
Probab=46.11  E-value=35  Score=24.87  Aligned_cols=31  Identities=13%  Similarity=0.400  Sum_probs=21.5

Q ss_pred             CCCCCCEEEEEEEeec-CCcccceEEEEEEEe
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRLSIYKGIVMSR  175 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRiQ~FeGIVIar  175 (201)
                      .|.+||+|.|++.|.. .+.+++..+--++.+
T Consensus        15 ~~~~Ge~i~v~v~i~n~s~~~i~~I~v~L~~~   46 (136)
T PF02752_consen   15 AYVPGETIPVNVEIDNQSKKKIKKIKVSLVER   46 (136)
T ss_dssp             EEETT--EEEEEEEEE-SSSEEEEEEEEEEEE
T ss_pred             EECCCCEEEEEEEEEECCCCEEEEEEEEEEEE
Confidence            3889999999999997 566666666555544


No 19 
>cd04497 hPOT1_OB1_like hPOT1_OB1_like: A subfamily of OB folds similar to the first OB fold (OB1) of human protection of telomeres 1 protein (hPOT1), the single OB fold of the N-terminal domain of Schizosaccharomyces pombe POT1 (SpPOT1), and the first OB fold of the N-terminal domain of the alpha subunit (OB1Nalpha) of Oxytricha nova telomere end binding protein (OnTEBP). POT1 proteins recognize single-stranded (ss) 3-prime ends of the telomere. A 3-prime ss overhang is conserved in ciliated protozoa, yeast, and mammals. SpPOT1 is essential for telomere maintenance. It binds specifically to the ss G-rich telomeric sequence (GGTTAC) of S. pombe. hPOT1 binds specifically to ss telomeric DNA repeats ending with the sequence GGTTAG. Deletion of the S. pombe pot1+ gene results in a rapid loss of telomere sequences, chromosome mis-segregation and chromosome circularization. hPOT1 is implicated in telomere length regulation. The hPOT1 monomer consists of two closely connected OB folds (OB1-OB
Probab=46.05  E-value=35  Score=27.09  Aligned_cols=41  Identities=17%  Similarity=0.379  Sum_probs=31.1

Q ss_pred             CCCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEe
Q 028968          141 RPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRR  188 (201)
Q Consensus       141 kdiPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRK  188 (201)
                      ..+|.+.+||+|.++=      =++|.|.|-..+..+. -.++|-|=+
T Consensus        64 ~~LP~v~~GDVIll~~------~kv~~~~g~~~~~~~~-~~ss~avf~  104 (138)
T cd04497          64 ESLPIVKVGDIILLRR------VKIQSYNGKPQGISND-RGSSWAVFR  104 (138)
T ss_pred             hhCCCCCCCCEEEEEE------EEEEEECCceEEEECC-CceeEEEEc
Confidence            4689899999999973      4788888888888776 346665544


No 20 
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed
Probab=44.41  E-value=34  Score=26.50  Aligned_cols=28  Identities=25%  Similarity=0.527  Sum_probs=21.8

Q ss_pred             CCCCCEEEEEEEeecCCcccceEEEEEE
Q 028968          146 IRTGDVVEIKLEVPENRRRLSIYKGIVM  173 (201)
Q Consensus       146 Fr~GDtVrV~v~I~EnKeRiQ~FeGIVI  173 (201)
                      .++||+|.+.+++.+.++++=.|.+.+.
T Consensus       102 v~pGd~l~i~~~i~~~~~~~v~~~~~~~  129 (147)
T PRK00006        102 VVPGDQLILEVELLKQRRGIWKFKGVAT  129 (147)
T ss_pred             cCCCCEEEEEEEEEEeeCCEEEEEEEEE
Confidence            3589999999999886566667777663


No 21 
>PF07977 FabA:  FabA-like domain;  InterPro: IPR013114 Fatty acids biosynthesis occurs by two distinct pathways: in fungi, mammals and mycobacteria, type I or associative fatty-acid biosynthesis (type I FAS) is accomplished by multifunctional proteins in which distinct domains catalyse specific reactions; in plants and most bacteria, type II or dissociative fatty-acid biosynthesis (type II FAS) is accomplished by distinct enzymes []. Both FabZ and FabA catalyse the dehydration of beta-hydroxyacyl acyl carrier protein (ACP) to trans 2-enoyl ACP. However, FabZ and FabA display subtle differences in substrate specificities, whereby FabA is most effective on acyl ACPs of 9-11 carbon atoms in length, while FabZ is less specific. Unlike FabA, FabZ does not function as an isomerase and cannot initiate unsaturated fatty acid biosynthesis. However, only FabZ can act during the elongation of unsaturated fatty acid chains. This enzyme domain has a HotDog fold.; PDB: 3D6X_F 2GLV_J 2GLM_E 2GLP_E 2GLL_C 1U1Z_F 3ESI_A 3AZB_T 3AZA_M 3AZ9_U ....
Probab=42.50  E-value=27  Score=26.91  Aligned_cols=30  Identities=20%  Similarity=0.501  Sum_probs=22.8

Q ss_pred             CCCCCCC-EEEEEEEeec---CCcccceEEEEEE
Q 028968          144 PDIRTGD-VVEIKLEVPE---NRRRLSIYKGIVM  173 (201)
Q Consensus       144 PeFr~GD-tVrV~v~I~E---nKeRiQ~FeGIVI  173 (201)
                      =.+.||| ++++.+.+.+   ....+-.|+|.+.
T Consensus        95 ~~v~Pg~~~l~~~v~i~~~~~~~~~~~~~~~~~~  128 (138)
T PF07977_consen   95 GPVYPGDKTLRIEVEIKKIRRREGGMAIFDGTAY  128 (138)
T ss_dssp             S-B-TTE-EEEEEEEEEEEEEEETTEEEEEEEEE
T ss_pred             ccEeCCCcEEEEEEEEEEeecccCCEEEEEEEEE
Confidence            3578999 9999999988   6777777887664


No 22 
>COG1566 EmrA Multidrug resistance efflux pump [Defense mechanisms]
Probab=42.39  E-value=74  Score=29.86  Aligned_cols=63  Identities=24%  Similarity=0.316  Sum_probs=45.7

Q ss_pred             HHhhhcCCCCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCC---------ccceEEEEeeeCCeeeEEEe
Q 028968          134 VEASESERPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAG---------IHTTIRIRRIIAGIGVEIVF  199 (201)
Q Consensus       134 IE~~q~kkdiPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~G---------i~sTFTVRKIs~GVGVER~F  199 (201)
                      |...+.+.+|..+++|+-++|++-.-...   ..|+|+|-++...-         .+.|+..-|+.+.+.|...|
T Consensus       247 V~AnFkETqL~~~r~Gq~a~I~~da~~~~---~~~~G~v~~i~~~tg~~fsllp~~natgN~tkvvQRvPVrI~l  318 (352)
T COG1566         247 VVANFKETQLARVRPGQPAEITLDAYPGN---GVVEGIVEGIAPATGSAFSLLPAQNATGNWTKVVQRVPVRIEL  318 (352)
T ss_pred             EEeeeeeeecCcccCCCeEEEEEEcCCCc---eEEEEEEEEecCCcccccccCCCccCCCCEEEEEEeeeEEEEe
Confidence            33445667899999999999998766532   89999999986431         24455556777877776655


No 23 
>TIGR02266 gmx_TIGR02266 Myxococcus xanthus paralogous domain TIGR02266. This domain is related to Type IV pilus assembly protein PilZ (Pfam model pfam07238). It is found in at least 12 copies in Myxococcus xanthus DK 1622.
Probab=42.12  E-value=97  Score=21.97  Aligned_cols=35  Identities=31%  Similarity=0.490  Sum_probs=25.7

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCC
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAG  179 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~G  179 (201)
                      ..+.+||.|.|.+.++.+...+. ..|.|+..+..+
T Consensus        35 ~~~~~g~~v~l~l~l~~~~~~i~-~~g~Vv~~~~~~   69 (96)
T TIGR02266        35 KPLAVGTRVELKLTLPGGERPVE-LKGVVAWVRPAA   69 (96)
T ss_pred             CCcCCCCEEEEEEEcCCCCeEEE-EEEEEEEeCCCC
Confidence            35789999999999987533333 579998877544


No 24 
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes. FkbR2  has sequence similarity to (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  The function of FkbR2 is unknown.
Probab=41.40  E-value=43  Score=25.45  Aligned_cols=16  Identities=25%  Similarity=0.262  Sum_probs=14.2

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .+++||+|.+..+|.+
T Consensus        91 pv~~GDtl~~~~~v~~  106 (146)
T cd03451          91 PVFHGDTLYAESEVLS  106 (146)
T ss_pred             CCCCCCEEEEEEEEEE
Confidence            4689999999999987


No 25 
>cd04455 S1_NusA S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. NusA is a transcription elongation factor containing an N-terminal catalytic domain and three RNA binding domains (RBD's). The RBD's include one S1 domain and two KH domains that form an RNA binding surface. DNA transcription by RNA polymerase (RNAP) includes three phases - initiation, elongation, and termination. During initiation, sigma factors bind RNAP and target RNAP to specific promoters. During elongation, N-utilization substances (NusA, B, E, and G) replace sigma factors and regulate pausing, termination, and antitermination. NusA is cold-shock-inducible.
Probab=41.39  E-value=39  Score=23.26  Aligned_cols=22  Identities=14%  Similarity=0.167  Sum_probs=16.1

Q ss_pred             CCCCCCEEEEEEEeec-CCcccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRLS  166 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRiQ  166 (201)
                      .|++||.|+|.+.-.+ ++++.|
T Consensus        40 ~~~~Gd~v~v~v~~v~~~~~~~~   62 (67)
T cd04455          40 SYRPGDRIKAYVLEVRKTSKGPQ   62 (67)
T ss_pred             cCCCCCEEEEEEEEEecCCCCCE
Confidence            5899999999987666 344433


No 26 
>cd05690 S1_RPS1_repeat_ec5 S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 5 (ec5) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=41.26  E-value=29  Score=23.20  Aligned_cols=22  Identities=27%  Similarity=0.320  Sum_probs=16.0

Q ss_pred             CCCCCCEEEEEEEeec-CCcccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRLS  166 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRiQ  166 (201)
                      .|++||.|+|.+.-.. .+.|+.
T Consensus        45 ~~~~G~~v~v~v~~id~~~~~i~   67 (69)
T cd05690          45 IYKKGQEVEAVVLNIDVERERIS   67 (69)
T ss_pred             EECCCCEEEEEEEEEECCcCEEe
Confidence            3899999999975554 555553


No 27 
>PRK07018 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed
Probab=40.26  E-value=87  Score=27.07  Aligned_cols=47  Identities=19%  Similarity=0.181  Sum_probs=33.8

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCe
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGI  193 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GV  193 (201)
                      .-|-++-||+|.|.+.-.    -++ ..-...|..+++++.+++|||...|-
T Consensus       173 ~~~~V~~G~~V~i~~~~g----~~~-i~~~G~Al~~G~~Gd~IrVrN~~Sgk  219 (235)
T PRK07018        173 QAWVVCKGQTVSIIARGD----GFS-VKTEGEALNDGAVGQQIRVRNMASGQ  219 (235)
T ss_pred             CccEeCCCCEEEEEEecC----CEE-EEEEEEEcCCCCCCCeEEEEECCCCC
Confidence            467799999999987632    111 12334778889999999999876653


No 28 
>cd00164 S1_like S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain. Both domains are members of the Oligonucleotide/oligosaccharide Binding (OB) fold.
Probab=40.11  E-value=35  Score=21.48  Aligned_cols=16  Identities=31%  Similarity=0.449  Sum_probs=13.0

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .|++||+|++.+.-..
T Consensus        41 ~~~~G~~v~~~v~~~d   56 (65)
T cd00164          41 VFKVGDEVEVKVLEVD   56 (65)
T ss_pred             EeCCCCEEEEEEEEEc
Confidence            4999999999886544


No 29 
>cd04471 S1_RNase_R S1_RNase_R: RNase R C-terminal S1 domain. RNase R is a processive 3' to 5' exoribonuclease, which is a homolog of RNase II. RNase R degrades RNA with secondary structure having a 3' overhang of at least 7 nucleotides. RNase R and PNPase play an important role in the degradation of RNA with extensive secondary structure, such as rRNA, tRNA, and certain mRNA which contains repetitive extragenic palindromic sequences. The C-terminal S1 domain binds ssRNA.
Probab=40.07  E-value=29  Score=23.87  Aligned_cols=23  Identities=26%  Similarity=0.541  Sum_probs=16.1

Q ss_pred             CCCCCCCEEEEEEEeec-CCcccc
Q 028968          144 PDIRTGDVVEIKLEVPE-NRRRLS  166 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~E-nKeRiQ  166 (201)
                      -.|++||+|+|.+.-.. .+.+++
T Consensus        56 ~~~~~gd~v~v~v~~vd~~~~~i~   79 (83)
T cd04471          56 KVFRLGDKVKVRVVRVDLDRRKID   79 (83)
T ss_pred             CEEcCCCEEEEEEEEeccccCEEE
Confidence            45899999999876654 344443


No 30 
>PF00238 Ribosomal_L14:  Ribosomal protein L14p/L23e;  InterPro: IPR000218 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L14 is one of the proteins from the large ribosomal subunit. In eubacteria, L14 is known to bind directly to the 23S rRNA. It belongs to a family of ribosomal proteins, which have been grouped on the basis of sequence similarities []. Based on amino-acid sequence homology, it is predicted that ribosomal protein L14 is a member of a recently identified family of structurally related RNA-binding proteins []. L14 is a protein of 119 to 137 amino-acid residues.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3IZR_M 4A1C_J 4A1E_J 4A1A_J 4A17_J 1VSP_I 3D5D_O 1VSA_I 3MRZ_K 3F1F_O ....
Probab=39.89  E-value=59  Score=26.00  Aligned_cols=36  Identities=11%  Similarity=0.337  Sum_probs=27.5

Q ss_pred             CCCCCCCCCEEEEEEEee--c-CCcccceEEEEEEEeec
Q 028968          142 PIPDIRTGDVVEIKLEVP--E-NRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~--E-nKeRiQ~FeGIVIarrn  177 (201)
                      ..+.-..||+|.|.++-.  . .-++=|+|.|+|+..+.
T Consensus        29 ~~~~a~vGD~I~vsVkk~~~~~~vkkg~v~~avIVrtk~   67 (122)
T PF00238_consen   29 RRKYASVGDIIVVSVKKGRPKSKVKKGQVYKAVIVRTKK   67 (122)
T ss_dssp             TTSEE-TTSEEEEEEEEE-SSSSSTTTEEEEEEEEECSS
T ss_pred             CccccccceEEEEEEeecccCccccccceEEEEEEEEeE
Confidence            456678999999999877  3 33555999999998765


No 31 
>COG2030 MaoC Acyl dehydratase [Lipid metabolism]
Probab=39.68  E-value=41  Score=27.18  Aligned_cols=17  Identities=24%  Similarity=0.458  Sum_probs=15.1

Q ss_pred             CCCCCCCEEEEEEEeec
Q 028968          144 PDIRTGDVVEIKLEVPE  160 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~E  160 (201)
                      -.+++||||++.+.+.+
T Consensus       105 ~PV~~Gdtl~~~~~v~~  121 (159)
T COG2030         105 KPVFPGDTLRARVEVLD  121 (159)
T ss_pred             CCCCCCCEEEEEEEEEE
Confidence            45899999999999987


No 32 
>cd05708 S1_Rrp5_repeat_sc12 S1_Rrp5_repeat_sc12: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 12 (sc12). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=39.00  E-value=36  Score=23.00  Aligned_cols=21  Identities=29%  Similarity=0.457  Sum_probs=15.2

Q ss_pred             CCCCCCEEEEEEEeec-CCccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRL  165 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRi  165 (201)
                      .|++||.|+|.+.=.. ++.|+
T Consensus        47 ~~~~Gd~v~v~i~~vd~~~~~i   68 (77)
T cd05708          47 LFRVGDKVRAKVLKIDAEKKRI   68 (77)
T ss_pred             eecCCCEEEEEEEEEeCCCCEE
Confidence            4899999999875544 45554


No 33 
>cd05703 S1_Rrp5_repeat_hs12_sc9 S1_Rrp5_repeat_hs12_sc9: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 12 (hs12) and S. cerevisiae S1 repeat 9 (sc9). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=38.00  E-value=40  Score=23.81  Aligned_cols=23  Identities=13%  Similarity=0.278  Sum_probs=17.0

Q ss_pred             CCCCCCEEEEEEEeec-CCcccce
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRLSI  167 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRiQ~  167 (201)
                      .|++||.|++.+.-.. +++|+.+
T Consensus        46 ~~~vG~~v~~kV~~id~~~~~i~L   69 (73)
T cd05703          46 KFPIGQALKAKVVGVDKEHKLLRL   69 (73)
T ss_pred             hCCCCCEEEEEEEEEeCCCCEEEE
Confidence            4999999999976554 5666553


No 34 
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division.  The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.
Probab=37.20  E-value=75  Score=25.63  Aligned_cols=33  Identities=6%  Similarity=0.166  Sum_probs=23.2

Q ss_pred             CCCCCEEEEEEEeec--CCc--ccceEEEEEEEeecC
Q 028968          146 IRTGDVVEIKLEVPE--NRR--RLSIYKGIVMSRQNA  178 (201)
Q Consensus       146 Fr~GDtVrV~v~I~E--nKe--RiQ~FeGIVIarrn~  178 (201)
                      +++||+|.+..+|.+  .++  |.++..=..|.++|.
T Consensus        98 V~~GDtl~~~~~V~~~~~~~~~~~~~~~~~~~~~~~~  134 (149)
T cd03450          98 VPVGSRVRGRFTLLSVEELKGGGVQVTLEVTVEIEGE  134 (149)
T ss_pred             eeCCcEEEEEEEEEEEEEcCCCeEEEEEEEEEEEeCC
Confidence            689999999999987  222  245666566666654


No 35 
>cd04452 S1_IF2_alpha S1_IF2_alpha: The alpha subunit of translation Initiation Factor 2, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Eukaryotic and archaeal Initiation Factor 2 (e- and aIF2, respectively) are heterotrimeric proteins with three subunits (alpha, beta, and gamma). IF2 plays a crucial role in the process of translation initiation. The IF2 gamma subunit contains a GTP-binding site. The IF2 beta and gamma subunits together are thought to be responsible for binding methionyl-initiator tRNA. The ternary complex consisting of IF2, GTP, and the methionyl-initiator tRNA binds to the small subunit of the ribosome, as part of a pre-initiation complex that scans the mRNA to find the AUG start codon. The IF2-bound GTP is hydrolyzed to GDP when the methionyl-initiator tRNA binds the AUG start codon, at which time the IF2 is released with its bound GDP. The large ribosomal subunit then joins with the small subunit to c
Probab=36.46  E-value=42  Score=22.80  Aligned_cols=15  Identities=13%  Similarity=0.244  Sum_probs=12.2

Q ss_pred             CCCCCEEEEEEEeec
Q 028968          146 IRTGDVVEIKLEVPE  160 (201)
Q Consensus       146 Fr~GDtVrV~v~I~E  160 (201)
                      |+.||+|+|.+.-.+
T Consensus        50 ~~~Gd~v~vkv~~~d   64 (76)
T cd04452          50 VKVGRKEVVKVIRVD   64 (76)
T ss_pred             eCCCCEEEEEEEEEE
Confidence            899999999866444


No 36 
>PF07238 PilZ:  PilZ domain;  InterPro: IPR009875 The ubiquitous bacterial second messenger cyclic-di-GMP (c-di-GMP) is associated with the regulation of biofilm formation, the control of exopolysaccharide synthesis, flagellar- and pili-based motility, gene expression, interactions of bacteria with eukaryotic hosts and multicellular behaviour in diverse bacteria. With the exception of bacterial cellulose synthases, the identities of c-di-GMP receptors and end targets of the proteins having one or more PilZ domains are mostly uncharacterised. However it was suggested that the PilZ domains present in the BcsA subunits of bacterial cellulose synthases function in c-di-GMP binding []. More recently YcgR (see IPR023787 from INTERPRO) was found to bind c-di-GMP tightly and specifically; also isolated PilZ domains from YcgR and BcsA bound c-di-GMP indicating that the PilZ domain was sufficient for binding of c-di-GMP and significantly that site-directed mutagenesis performed on YcgR implicated the most conserved residues in the PilZ domain directly in c-di-GMP binding []. It was suggested that c-di-GMP binding to PilZ brings about conformational changes in the protein that stabilise the bound ligand and probability initiates the downstream signal transduction cascade. In the case of YcgR, c-di-GMP binding regulates flagellum-based motility in a c-di-GMP-dependent manner (see IPR023787 from INTERPRO) []. The association of the PilZ domain with a variety of other domains, including likely components of bacterial multidrug secretion system, could provide clues to multiple functions of the c-di-GMP in bacterial pathogenesis and cell development. Binding and mutagenesis studies of several PilZ domain proteins have confirmed this observation and demonstrated that c-di-GMP binding depends on residues in RxxxR and D/NxSxxG sequence motifs. The crystal structure, at 1.7 A, of a PilZ domain::c-di-GMP complex from Vibrio cholerae shows c-di-GMP contacting seven of nine strongly conserved residues. Binding of c-di-GMP causes a conformational switch whereby the C- and N-terminal domains are brought into close opposition forming a new allosteric interaction surface that spans these domains and the c-di-GMP at their interface []. ; GO: 0035438 cyclic-di-GMP binding; PDB: 2RDE_B 1YLN_A 3KYG_A 3DSG_B 2GJG_A 3KYF_A 1YWU_A 2L74_A 2L1T_A 3CNR_A ....
Probab=36.15  E-value=1.1e+02  Score=20.83  Aligned_cols=32  Identities=22%  Similarity=0.379  Sum_probs=23.5

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEEEEeecC
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNA  178 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~  178 (201)
                      .+.+||.|.|.+.+.....-.  +.|.|+..++.
T Consensus        44 ~~~~~~~v~l~~~~~~~~~~~--~~~~V~~~~~~   75 (102)
T PF07238_consen   44 PLEPGDRVRLSFSLPGGGFPI--VTGRVVRIQKD   75 (102)
T ss_dssp             G--TTSEEEEEEECTTTSCEE--EEEEEEEEEEE
T ss_pred             CCCCCCEEEEEEEeCCCCeeE--EEEEEEEEECC
Confidence            789999999988777633322  99999998877


No 37 
>COG2139 RPL21A Ribosomal protein L21E [Translation, ribosomal structure and biogenesis]
Probab=35.93  E-value=40  Score=26.88  Aligned_cols=40  Identities=20%  Similarity=0.324  Sum_probs=30.2

Q ss_pred             CCCCCCCCCCEEEEEEEeec----CCcccceEEEEEEEeecCCc
Q 028968          141 RPIPDIRTGDVVEIKLEVPE----NRRRLSIYKGIVMSRQNAGI  180 (201)
Q Consensus       141 kdiPeFr~GDtVrV~v~I~E----nKeRiQ~FeGIVIarrn~Gi  180 (201)
                      +-|-+|++||.|-+.+.=.=    --.|.|=..|+|+..+|+..
T Consensus        28 r~l~ey~~Gd~V~I~IdpSv~kGmPh~rf~G~TG~Vvg~~g~ay   71 (98)
T COG2139          28 RYLQEYKVGDKVHIDIDPSVHKGMPHPRFQGKTGTVVGVRGRAY   71 (98)
T ss_pred             hHHhhccCCCEEEEEeCcccccCCCCccccCcceEEEeccCCEE
Confidence            44668999999877654322    25799999999999998653


No 38 
>cd05706 S1_Rrp5_repeat_sc10 S1_Rrp5_repeat_sc10: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 10 (sc10). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=35.86  E-value=46  Score=22.66  Aligned_cols=15  Identities=13%  Similarity=0.248  Sum_probs=12.5

Q ss_pred             CCCCCEEEEEEEeec
Q 028968          146 IRTGDVVEIKLEVPE  160 (201)
Q Consensus       146 Fr~GDtVrV~v~I~E  160 (201)
                      |++||+|++.+.-..
T Consensus        48 ~~~Gd~v~~~V~~~d   62 (73)
T cd05706          48 FKKNDIVRACVLSVD   62 (73)
T ss_pred             cCCCCEEEEEEEEEe
Confidence            999999999876554


No 39 
>cd04491 SoSSB_OBF SoSSB_OBF: A subfamily of OB folds similar to the OB fold of the crenarchaeote Sulfolobus solfataricus single-stranded (ss) DNA-binding protein (SSoSSB). SSoSSB has a single OB fold, and it physically and functionally interacts with RNA polymerase. In vitro, SSoSSB can substitute for the basal transcription factor TBP, stimulating transcription from promoters under conditions in which TBP is limiting, and supporting transcription when TBP is absent. SSoSSB selectively melts the duplex DNA of promoter sequences. It also relieves transcriptional repression by the chromatin Alba. In addition, SSoSSB activates reverse gyrase activity, which involves DNA binding, DNA cleavage, strand passage and ligation. SSoSSB stimulates all these steps in the presence of the chromatin protein, Sul7d. SSoSSB antagonizes the inhibitory effect of Sul7d on reverse gyrase supercoiling activity. It also physically and functionally interacts with Mini-chromosome Maintenance (MCM), stimulating 
Probab=35.75  E-value=49  Score=23.41  Aligned_cols=26  Identities=38%  Similarity=0.493  Sum_probs=20.4

Q ss_pred             CCCCCCCCEEEEE-EEeecCCcccceE
Q 028968          143 IPDIRTGDVVEIK-LEVPENRRRLSIY  168 (201)
Q Consensus       143 iPeFr~GDtVrV~-v~I~EnKeRiQ~F  168 (201)
                      .+.+.+||+|++. .++.+-+.+.|+.
T Consensus        46 ~~~~~~G~vv~i~~~~v~~~~g~~ql~   72 (82)
T cd04491          46 ADDLEPGDVVRIENAYVREFNGRLELS   72 (82)
T ss_pred             cccCCCCCEEEEEeEEEEecCCcEEEE
Confidence            6779999999999 8888755556654


No 40 
>cd05688 S1_RPS1_repeat_ec3 S1_RPS1_repeat_ec3: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 3 (ec3) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=35.54  E-value=41  Score=21.97  Aligned_cols=15  Identities=33%  Similarity=0.523  Sum_probs=12.4

Q ss_pred             CCCCCEEEEEEEeec
Q 028968          146 IRTGDVVEIKLEVPE  160 (201)
Q Consensus       146 Fr~GDtVrV~v~I~E  160 (201)
                      |++||.|+|.+.-..
T Consensus        45 ~~~Gd~v~v~i~~vd   59 (68)
T cd05688          45 VNVGDEVEVKVLKID   59 (68)
T ss_pred             ECCCCEEEEEEEEEE
Confidence            899999999876554


No 41 
>cd08544 Reeler Reeler, the N-terminal domain of reelin, F-spondin, and a variety of other proteins. This domain is found at the N-terminus of F-spondin, a protein attached to the extracellular matrix, which plays roles in neuronal development and vascular remodelling. The F-spondin reeler domain has been reported to bind heparin. The reeler domain is also found at the N-terminus of reelin, an extracellular glycoprotein involved in the development of the brain cortex, and in a variety of other eukaryotic proteins with different domain architectures, including the animal ferric-chelate reductase 1 or stromal cell-derived receptor 2, a member of the cytochrome B561 family, which reduces ferric iron before its transport from the endosome to the cytoplasm. Also included is the insect putative defense protein 1, which is expressed upon bacterial infection and appears to contain a single reeler domain.
Probab=35.48  E-value=86  Score=24.24  Aligned_cols=31  Identities=16%  Similarity=0.383  Sum_probs=26.3

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEEEEeecCC
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAG  179 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~G  179 (201)
                      .+.||+.+.|++.-...    ..|+|..|.-|+.+
T Consensus        29 ~y~pG~~~~Vtl~~~~~----~~F~GF~lqAr~~~   59 (135)
T cd08544          29 SYVPGETYTVTLSGSSP----SPFRGFLLQARDAS   59 (135)
T ss_pred             EECCCCEEEEEEECCCC----CceeEEEEEEEcCC
Confidence            68999999999986543    89999999988865


No 42 
>cd05705 S1_Rrp5_repeat_hs14 S1_Rrp5_repeat_hs14: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 14 (hs14). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=35.03  E-value=44  Score=23.79  Aligned_cols=22  Identities=9%  Similarity=0.196  Sum_probs=17.0

Q ss_pred             CCCCCCEEEEEEEeec-CCcccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRLS  166 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRiQ  166 (201)
                      .|++||.|++.+.-.+ ++.|+.
T Consensus        50 ~~~~G~~v~~kVl~id~~~~~i~   72 (74)
T cd05705          50 YLPEGKLLTAKVLSVNSEKNLVE   72 (74)
T ss_pred             ccCCCCEEEEEEEEEECCCCEEe
Confidence            4899999999987665 566654


No 43 
>PF08207 EFP_N:  Elongation factor P (EF-P) KOW-like domain;  InterPro: IPR013185  This entry represents the N-terminal domain of homologues of elongation factor P, which probably are translation initiation factors. ; PDB: 3TRE_A 1YBY_A 1IZ6_B 1UEB_B 3HUW_V 3HUY_V 3A5Z_H 3OYY_B.
Probab=34.96  E-value=1.4e+02  Score=20.63  Aligned_cols=49  Identities=22%  Similarity=0.374  Sum_probs=26.6

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEEEEeecCC-ccceEEEEeeeCCeeeEEEee
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAG-IHTTIRIRRIIAGIGVEIVFP  200 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~G-i~sTFTVRKIs~GVGVER~FP  200 (201)
                      +|+.|.+|.+.=    .--++.-|   .-.+.|+| .--...+|++..|.-+|++|.
T Consensus         4 dlr~G~~i~~~g----~~~~V~~~---~~~k~gkg~a~v~~klknl~tG~~~e~tf~   53 (58)
T PF08207_consen    4 DLRKGMVIEIDG----EPYVVLDF---QHVKPGKGGAFVRVKLKNLRTGSKVEKTFR   53 (58)
T ss_dssp             G--TTSEEEETT----EEEEEEEE---EEECCTTSSSEEEEEEEETTTTEEEEEEEE
T ss_pred             HccCCCEEEECC----EEEEEEEE---EEECCCCCCeEEEEEEEECCCCCEEEEEEC
Confidence            578888876620    00112222   22233444 123345999999999999995


No 44 
>PF09926 DUF2158:  Uncharacterized small protein (DUF2158);  InterPro: IPR019226 This entry represents a family of predominantly prokaryotic proteins with no known function. 
Probab=34.59  E-value=26  Score=24.60  Aligned_cols=10  Identities=50%  Similarity=0.963  Sum_probs=8.6

Q ss_pred             CCCCCEEEEE
Q 028968          146 IRTGDVVEIK  155 (201)
Q Consensus       146 Fr~GDtVrV~  155 (201)
                      |++||+|+++
T Consensus         1 f~~GDvV~LK   10 (53)
T PF09926_consen    1 FKIGDVVQLK   10 (53)
T ss_pred             CCCCCEEEEc
Confidence            7899999876


No 45 
>PRK06005 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed
Probab=34.43  E-value=1.1e+02  Score=25.32  Aligned_cols=48  Identities=17%  Similarity=0.223  Sum_probs=33.9

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCee
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIG  194 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVG  194 (201)
                      .-+-++-||.|.+.+.-.-  =++ ...|  +|..+.+.+.++.|||...|-=
T Consensus        97 ~p~~V~rG~~V~i~~~~~g--~~i-~~~G--~Al~~G~~Gd~IrVrN~~Sgki  144 (160)
T PRK06005         97 EPSLVTRGSPVKLVFSAGG--LTI-TAAG--TPLQSGAAGDLIRVRNVDSGVI  144 (160)
T ss_pred             CCcEEeCCCEEEEEEecCC--EEE-EEEE--EEcccCCCCCEEEEEECCCCCE
Confidence            4567999999999886432  111 1223  6777889999999999876643


No 46 
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional
Probab=34.43  E-value=64  Score=26.93  Aligned_cols=30  Identities=20%  Similarity=0.166  Sum_probs=21.7

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEE
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVM  173 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVI  173 (201)
                      -..+|||++.++.++.+.+.++-.+++.+-
T Consensus       137 kPV~pGD~L~~ea~v~~~~~~~~~v~~~~~  166 (185)
T PRK04424        137 RPVKLGERVVAKAEVVRKKGNKYIVEVKSY  166 (185)
T ss_pred             cCCCCCCEEEEEEEEEEccCCEEEEEEEEE
Confidence            357899999999999985555445555444


No 47 
>PRK05483 rplN 50S ribosomal protein L14; Validated
Probab=34.36  E-value=70  Score=25.87  Aligned_cols=34  Identities=15%  Similarity=0.277  Sum_probs=26.2

Q ss_pred             CCCCCCCEEEEEEEeec--C-CcccceEEEEEEEeec
Q 028968          144 PDIRTGDVVEIKLEVPE--N-RRRLSIYKGIVMSRQN  177 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~E--n-KeRiQ~FeGIVIarrn  177 (201)
                      +.-.+||+|.|.++-..  . -.|=|++.|+|+..+.
T Consensus        31 ~~a~iGD~I~vsVkk~~~~~~~kkg~v~~AvIVrtkk   67 (122)
T PRK05483         31 RYASIGDVIVVSVKEAIPRGKVKKGDVVKAVVVRTKK   67 (122)
T ss_pred             CccccCCEEEEEEEEcCCCCcccCCCEeeEEEEEecc
Confidence            56789999999987433  2 3567999999998763


No 48 
>cd06462 Peptidase_S24_S26 The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the repressor of genes in the cellular SOS response to DNA damage; MucA and the related UmuD proteins, which are lesion-bypass DNA polymerases, induced in response to mitogenic DNA damage; RulA, a component of the rulAB locus that confers resistance to UV, and RuvA, which is a component of the RuvABC resolvasome that catalyzes the resolution of Holliday junctions that arise during genetic recombination and DNA repair. The S26 type I signal peptidase (SPase) family also includes mitochondrial inner membrane protease (IMP)-like members. SPases are essential membrane-bound proteases which function to cleave away the amino-terminal signal peptide from the translocated pre-protein, thus playing a crucial role in the tr
Probab=34.19  E-value=84  Score=21.21  Aligned_cols=43  Identities=21%  Similarity=0.302  Sum_probs=26.4

Q ss_pred             CCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCe
Q 028968          143 IPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGI  193 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GV  193 (201)
                      .|.|..||+|-|.-.-.      ..-.|-+++.+..|  ..+++|++...-
T Consensus        11 ~P~i~~gd~v~i~~~~~------~~~~G~iv~~~~~~--~~~~ikrl~~~~   53 (84)
T cd06462          11 EPTIPDGDLVLVDKSSY------EPKRGDIVVFRLPG--GELTVKRVIGLP   53 (84)
T ss_pred             cCcccCCCEEEEEecCC------CCcCCEEEEEEcCC--CcEEEEEEEEEC
Confidence            47899999998873211      33445444444444  568888876543


No 49 
>TIGR00405 L26e_arch ribosomal protein L24p/L26e, archaeal. This protein contains a KOW domain, shared by bacterial NusG and the L24p/L26e family of ribosomal proteins. Although called archaeal NusG in several publications, it is the only close homolog of eukaryotic L26e in archaeal genomes, shares an operon with L11 in many genomes, and has been sequenced from purified ribosomes. It is here designated as a ribosomal protein for these reasons.
Probab=34.07  E-value=1.7e+02  Score=23.02  Aligned_cols=43  Identities=21%  Similarity=0.283  Sum_probs=28.6

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCee
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIG  194 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVG  194 (201)
                      ..|.+||.|+|.      ..=++=|+|+|+...+...  -.+|.=+..|.-
T Consensus        85 ~~~~~Gd~V~I~------~GPf~G~~g~v~~~d~~k~--~v~v~l~~~~~~  127 (145)
T TIGR00405        85 ESIKKGDIVEII------SGPFKGERAKVIRVDESKE--EVTLELIEAAVP  127 (145)
T ss_pred             cccCCCCEEEEe------ecCCCCCeEEEEEEcCCCC--EEEEEEEEcCcc
Confidence            459999999985      2557778899988865433  344444444444


No 50 
>PRK08571 rpl14p 50S ribosomal protein L14P; Reviewed
Probab=34.03  E-value=1.5e+02  Score=24.53  Aligned_cols=36  Identities=17%  Similarity=0.409  Sum_probs=28.1

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeec
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn  177 (201)
                      .+|.-.+||+|.|.++-.....|=|++.++|+..+.
T Consensus        43 r~~~a~iGD~IvvsVK~~~p~~kg~v~kAVIVRtkk   78 (132)
T PRK08571         43 RLPKAGVGDMVVVSVKKGTPEMRKQVLRAVVVRQRK   78 (132)
T ss_pred             cCCccccCCEEEEEEEECCCcccCCEeEEEEEEecc
Confidence            357789999999998765533456999999998663


No 51 
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase].  Catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  The structure of the monomer includes a five-strand antiparallel beta-sheet wrapped around a central alpha helix, referred to as a hot dog fold.  The active site lies within a substrate-binding tunnel formed by the homodimer.  Other enzymes with this fold include MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE),  and the fatty acid synthase beta subunit.
Probab=33.97  E-value=1.2e+02  Score=21.83  Aligned_cols=17  Identities=24%  Similarity=0.454  Sum_probs=14.9

Q ss_pred             CCCCCCCEEEEEEEeec
Q 028968          144 PDIRTGDVVEIKLEVPE  160 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~E  160 (201)
                      =.+++||+|.+..+|.+
T Consensus        79 ~Pv~~Gd~l~~~~~v~~   95 (127)
T cd03441          79 APVFPGDTLRVEVEVLG   95 (127)
T ss_pred             CCcCCCCEEEEEEEEEE
Confidence            35799999999999987


No 52 
>cd05685 S1_Tex S1_Tex: The C-terminal S1 domain of a transcription accessory factor called Tex, which has been characterized in Bordetella pertussis and Pseudomonas aeruginosa. The tex gene is essential in Bortella pertusis and is named for its role in toxin expression. Tex has two functional domains, an N-terminal domain homologous to the Escherichia coli maltose repression protein, which is a poorly defined transcriptional factor, and a C-terminal S1 RNA-binding domain. Tex is found in prokaryotes, eukaryotes, and archaea.
Probab=33.22  E-value=53  Score=21.28  Aligned_cols=20  Identities=35%  Similarity=0.682  Sum_probs=14.6

Q ss_pred             CCCCCEEEEEEEeec-CCccc
Q 028968          146 IRTGDVVEIKLEVPE-NRRRL  165 (201)
Q Consensus       146 Fr~GDtVrV~v~I~E-nKeRi  165 (201)
                      |++||.|+|.+.=.. .+.++
T Consensus        45 ~~~Gd~v~v~i~~vd~~~~~i   65 (68)
T cd05685          45 VSVGDIVEVKVISIDEERGRI   65 (68)
T ss_pred             cCCCCEEEEEEEEEECCCCEE
Confidence            899999999876554 34444


No 53 
>cd05686 S1_pNO40 S1_pNO40: pNO40 , S1-like RNA-binding domain. pNO40 is a nucleolar protein of unknown function with an N-terminal S1 RNA binding domain, a CCHC type zinc finger, and clusters of basic amino acids representing a potential nucleolar targeting signal.  pNO40 was identified through a yeast two-hybrid interaction screen of a human kidney cDNA library using the pinin (pnn) protein as bait. pNO40 is thought to play a role in ribosome maturation and/or biogenesis.
Probab=32.10  E-value=55  Score=22.79  Aligned_cols=21  Identities=19%  Similarity=0.321  Sum_probs=14.5

Q ss_pred             CCCCCEEEEEEEeecCCcccc
Q 028968          146 IRTGDVVEIKLEVPENRRRLS  166 (201)
Q Consensus       146 Fr~GDtVrV~v~I~EnKeRiQ  166 (201)
                      |+.||+|+|.+.=.+...|++
T Consensus        49 ~~~Gd~v~vkv~~vd~~~ki~   69 (73)
T cd05686          49 VDVGEKVWVKVIGREMKDKMK   69 (73)
T ss_pred             ECCCCEEEEEEEEECCCCcEE
Confidence            799999999876554222544


No 54 
>TIGR00008 infA translation initiation factor IF-1. This family consists of translation initiation factor IF-1 as found in bacteria and chloroplasts. This protein, about 70 residues in length, consists largely of an S1 RNA binding domain (pfam00575).
Probab=31.48  E-value=34  Score=25.24  Aligned_cols=26  Identities=27%  Similarity=0.362  Sum_probs=18.5

Q ss_pred             CCCCCCCCCCCEEEEEEEeec-CCccc
Q 028968          140 ERPIPDIRTGDVVEIKLEVPE-NRRRL  165 (201)
Q Consensus       140 kkdiPeFr~GDtVrV~v~I~E-nKeRi  165 (201)
                      ++.---+.+||.|.|.+.--+ +|-||
T Consensus        39 r~~rI~I~~GD~V~Ve~spyd~tkgrI   65 (68)
T TIGR00008        39 RMHYIRILPGDKVKVELSPYDLTRGRI   65 (68)
T ss_pred             hhccEEECCCCEEEEEECcccCCcEeE
Confidence            334455899999999987665 55554


No 55 
>cd05697 S1_Rrp5_repeat_hs5 S1_Rrp5_repeat_hs5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 5 (hs5) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=30.74  E-value=63  Score=21.89  Aligned_cols=22  Identities=27%  Similarity=0.413  Sum_probs=15.9

Q ss_pred             CCCCCCEEEEEEEeec-CCcccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRLS  166 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRiQ  166 (201)
                      .|+.||+|++.+.-.. .+.|+.
T Consensus        44 ~~~~Gd~i~~~V~~id~~~~~i~   66 (69)
T cd05697          44 KFKPGLKVKCRVLSVEPERKRLV   66 (69)
T ss_pred             cCCCCCEEEEEEEEEECCCCEEE
Confidence            4999999999876555 444543


No 56 
>PRK15136 multidrug efflux system protein EmrA; Provisional
Probab=30.69  E-value=91  Score=28.70  Aligned_cols=33  Identities=18%  Similarity=0.384  Sum_probs=23.4

Q ss_pred             CCCCCCCCCCEEEEEEEeecCCcccceEEEEEEEee
Q 028968          141 RPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQ  176 (201)
Q Consensus       141 kdiPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarr  176 (201)
                      .++..+++|+.|.|.+-.-.+   -+.|.|.|..+.
T Consensus       261 ~~l~~v~~Gq~V~I~~da~p~---~~~~~G~V~~I~  293 (390)
T PRK15136        261 TQLANMRIGQPATITSDIYGD---DVVYTGKVVGLD  293 (390)
T ss_pred             HHHhcCCCCCEEEEEEecCCC---CceEEEEEEEEC
Confidence            356788899988887654322   136999999883


No 57 
>PRK02268 hypothetical protein; Provisional
Probab=30.60  E-value=64  Score=26.81  Aligned_cols=36  Identities=14%  Similarity=0.301  Sum_probs=26.3

Q ss_pred             CCCCCCCCCCEEEEEEEeec--CCcccceEEEEEEEee
Q 028968          141 RPIPDIRTGDVVEIKLEVPE--NRRRLSIYKGIVMSRQ  176 (201)
Q Consensus       141 kdiPeFr~GDtVrV~v~I~E--nKeRiQ~FeGIVIarr  176 (201)
                      ..|-.+++||.|-....-..  ++...|.|.||=.-..
T Consensus        31 apl~RmkpGD~ivyYsp~~~~~~~~~~qaftAig~V~~   68 (141)
T PRK02268         31 APLRRMKPGDWIIYYSPKTTFGGKDKLQAFTAIGKVKD   68 (141)
T ss_pred             chhhcCCCCCEEEEEeceEecCCCcccceEEEEEEEcC
Confidence            45778999999987653322  7889999999765433


No 58 
>PRK03999 translation initiation factor IF-5A; Provisional
Probab=30.35  E-value=1.2e+02  Score=24.43  Aligned_cols=54  Identities=17%  Similarity=0.195  Sum_probs=30.6

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCeeeEEEee
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGVEIVFP  200 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGVER~FP  200 (201)
                      ..++|+.|++|.+.=..    -++--++-.--.++| +.--.+.+|++..|-=+|++|+
T Consensus         7 ~~~~lrkG~~i~~~g~p----~~V~~~~~~kpGkhg-~a~vr~k~knL~tG~~~e~~~~   60 (129)
T PRK03999          7 EVGELKEGSYVVIDGEP----CKIVEISKSKPGKHG-SAKARIVAIGIFDGQKRSLVQP   60 (129)
T ss_pred             cHHHccCCCEEEECCEE----EEEEEEEeecCCCCC-cEEEEEEEEECCCCCEEEEEec
Confidence            56899999999754100    011111111111111 2245677899999988888886


No 59 
>PRK06461 single-stranded DNA-binding protein; Reviewed
Probab=30.22  E-value=55  Score=25.88  Aligned_cols=28  Identities=25%  Similarity=0.400  Sum_probs=21.1

Q ss_pred             CCCCCCCCEEEEE-EEeecCCcccceEEE
Q 028968          143 IPDIRTGDVVEIK-LEVPENRRRLSIYKG  170 (201)
Q Consensus       143 iPeFr~GDtVrV~-v~I~EnKeRiQ~FeG  170 (201)
                      .+.|++||+|+|. -++.+-+.++|+--|
T Consensus        62 a~~l~~GdvV~I~na~v~~f~G~lqL~i~   90 (129)
T PRK06461         62 AGSLKEGEVVEIENAWTTLYRGKVQLNVG   90 (129)
T ss_pred             cccCCCCCEEEEECcEEeeeCCEEEEEEC
Confidence            4568999999999 777775566776655


No 60 
>TIGR01067 rplN_bact ribosomal protein L14, bacterial/organelle. This model distinguishes bacterial and most organellar examples of ribosomal protein L14 from all archaeal and eukaryotic forms.
Probab=30.17  E-value=97  Score=25.01  Aligned_cols=34  Identities=12%  Similarity=0.253  Sum_probs=26.3

Q ss_pred             CCCCCCCEEEEEEEeec--C-CcccceEEEEEEEeec
Q 028968          144 PDIRTGDVVEIKLEVPE--N-RRRLSIYKGIVMSRQN  177 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~E--n-KeRiQ~FeGIVIarrn  177 (201)
                      +.-.+||+|.|.++-..  . -.|=|++.|+|+..+.
T Consensus        31 ~~a~iGD~I~vsVk~~~~~~~~kkg~v~~AvIVrtkk   67 (122)
T TIGR01067        31 RYATVGDVIVVVVKDAIPNGKVKKGDVVKAVIVRTKK   67 (122)
T ss_pred             CccccCCEEEEEEEEcCCCCccccccEEEEEEEEeec
Confidence            55889999999987433  2 3567999999998763


No 61 
>PF00717 Peptidase_S24:  Peptidase S24-like peptidase classification. ;  InterPro: IPR019759 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ].; PDB: 1KCA_H 3BDN_A 1F39_A 1JHH_A 1JHE_B 3JSP_A 1JHF_B 1JHC_A 3JSO_B 1B12_D ....
Probab=30.03  E-value=42  Score=22.45  Aligned_cols=40  Identities=23%  Similarity=0.405  Sum_probs=21.7

Q ss_pred             CCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeee
Q 028968          143 IPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRII  190 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs  190 (201)
                      .|.|+.||+|-|.-..     .++.-. +|+.+.+.+ . ..+++++.
T Consensus         8 ~P~i~~Gd~v~v~~~~-----~~~~gd-ivv~~~~~~-~-~~~iKrv~   47 (70)
T PF00717_consen    8 EPTIKDGDIVLVDPSS-----EPKDGD-IVVVKIDGD-E-ELYIKRVV   47 (70)
T ss_dssp             GGTSSTTEEEEEEETS--------TTS-EEEEEETTE-E-SEEEEEEE
T ss_pred             ccCeeCCCEEEEEEcC-----CCccCe-EEEEEECCc-e-eeEEEEEE
Confidence            4889999999887322     222222 333333222 1 57788875


No 62 
>cd05698 S1_Rrp5_repeat_hs6_sc5 S1_Rrp5_repeat_hs6_sc5: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 6 (hs6) and S. cerevisiae S1 repeat 5 (sc5). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=29.88  E-value=67  Score=21.59  Aligned_cols=15  Identities=33%  Similarity=0.558  Sum_probs=12.5

Q ss_pred             CCCCCEEEEEEEeec
Q 028968          146 IRTGDVVEIKLEVPE  160 (201)
Q Consensus       146 Fr~GDtVrV~v~I~E  160 (201)
                      |++||+|+|.+.-..
T Consensus        45 ~~~G~~i~v~v~~~d   59 (70)
T cd05698          45 FRVGQVVKVKVLSCD   59 (70)
T ss_pred             ccCCCEEEEEEEEEc
Confidence            999999999876554


No 63 
>PRK08559 nusG transcription antitermination protein NusG; Validated
Probab=29.76  E-value=2.3e+02  Score=22.97  Aligned_cols=41  Identities=20%  Similarity=0.275  Sum_probs=28.4

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCC
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAG  192 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~G  192 (201)
                      -.|++||.|+|.      ..=.+-|+|.|+...+..  ...+|.=+-+.
T Consensus        93 ~~~~~G~~V~I~------~Gpf~g~~g~V~~vd~~k--~~v~v~ll~~~  133 (153)
T PRK08559         93 EGIKEGDIVELI------AGPFKGEKARVVRVDESK--EEVTVELLEAA  133 (153)
T ss_pred             cCCCCCCEEEEe------ccCCCCceEEEEEEcCCC--CEEEEEEECCc
Confidence            359999999996      356777899999987542  22555544444


No 64 
>cd05689 S1_RPS1_repeat_ec4 S1_RPS1_repeat_ec4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (ec4) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=29.35  E-value=60  Score=22.03  Aligned_cols=21  Identities=33%  Similarity=0.490  Sum_probs=15.2

Q ss_pred             CCCCCCEEEEEEEeec-CCccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRL  165 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRi  165 (201)
                      .|+.||.|+|.+.=.+ .+.|+
T Consensus        48 ~~~~Gd~v~v~v~~id~~~~~i   69 (72)
T cd05689          48 VVSLGDEVEVMVLDIDEERRRI   69 (72)
T ss_pred             EeCCCCEEEEEEEEeeCCcCEE
Confidence            4899999999875544 44554


No 65 
>PF13437 HlyD_3:  HlyD family secretion protein
Probab=29.10  E-value=1.7e+02  Score=21.02  Aligned_cols=44  Identities=25%  Similarity=0.351  Sum_probs=30.2

Q ss_pred             CCCCCCCC-CCCEEEEEEEeecCCcccceEEEEEEEeecCCc--cceEEEE
Q 028968          140 ERPIPDIR-TGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGI--HTTIRIR  187 (201)
Q Consensus       140 kkdiPeFr-~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi--~sTFTVR  187 (201)
                      .+++..++ +||.|++++.  ...+  +.|.|.|..+....-  +.+|.++
T Consensus        44 ~~~~~~i~~~g~~v~v~~~--~~~~--~~~~g~V~~I~~~~~~~~~~~~v~   90 (105)
T PF13437_consen   44 EKDIARIKDPGQKVTVRLD--PGPE--KTIEGKVSSISPSPDPQGGTYRVE   90 (105)
T ss_pred             hHhhcceEeCCCEEEEEEC--CCCC--cEEEEEEEEEeCcccCCCcEEEEE
Confidence            35677887 9999999987  2222  299999999877322  2356554


No 66 
>cd05704 S1_Rrp5_repeat_hs13 S1_Rrp5_repeat_hs13: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits.  Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions.  Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 13 (hs13). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=28.98  E-value=67  Score=22.48  Aligned_cols=22  Identities=9%  Similarity=0.218  Sum_probs=15.4

Q ss_pred             CCCCCCCEEEEEEEeecCCcccc
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLS  166 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ  166 (201)
                      ..|++||.|++.+.-. ++.|++
T Consensus        47 ~~~~~Gd~v~~kV~~~-~~~~i~   68 (72)
T cd05704          47 EGFKPGKIVRCCILSK-KDGKYQ   68 (72)
T ss_pred             HhCCCCCEEEEEEEEe-cCCEEE
Confidence            4599999999987544 335554


No 67 
>PF10447 EXOSC1:  Exosome component EXOSC1/CSL4;  InterPro: IPR019495  The exosome mediates degradation of unstable mRNAs that contain AU-rich elements (AREs) within their 3' untranslated regions []. The proteins in this entry are components of the exosome 3'->5' exoribonuclease complex. They do not have exonuclease activity, but are required for the 3'-processing of the 7S pre-RNA to the mature 5.8S rRNA and for mRNA decay [, ].; PDB: 2NN6_I.
Probab=28.68  E-value=40  Score=25.44  Aligned_cols=14  Identities=29%  Similarity=0.551  Sum_probs=8.9

Q ss_pred             CCCCCCCCEEEEEE
Q 028968          143 IPDIRTGDVVEIKL  156 (201)
Q Consensus       143 iPeFr~GDtVrV~v  156 (201)
                      .-.|+|||+|+=.+
T Consensus        66 ~~~FrpGDIVrA~V   79 (82)
T PF10447_consen   66 YDCFRPGDIVRARV   79 (82)
T ss_dssp             GGT--SSSEEEEEE
T ss_pred             HhccCCCCEEEEEE
Confidence            34699999998654


No 68 
>cd05707 S1_Rrp5_repeat_sc11 S1_Rrp5_repeat_sc11: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes S. cerevisiae S1 repeat 11 (sc11). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=28.56  E-value=69  Score=21.60  Aligned_cols=21  Identities=19%  Similarity=0.398  Sum_probs=14.8

Q ss_pred             CCCCCCEEEEEEEeec-CCccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRL  165 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRi  165 (201)
                      .|++||.|++.+.-.. .+.|+
T Consensus        44 ~~~~Gd~v~~~v~~~d~~~~~i   65 (68)
T cd05707          44 RFKVGQLVKGKIVSIDPDNGRI   65 (68)
T ss_pred             ccCCCCEEEEEEEEEeCCCCEE
Confidence            3999999999876544 34444


No 69 
>PTZ00054 60S ribosomal protein L23; Provisional
Probab=28.53  E-value=1.2e+02  Score=25.28  Aligned_cols=35  Identities=14%  Similarity=0.357  Sum_probs=27.8

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceEEEEEEEee
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQ  176 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarr  176 (201)
                      .+|.-.+||+|.|.++-...-.|=|++.++|+..+
T Consensus        50 r~~~a~iGD~IvvsVKk~~p~~kg~V~kAVIVRtK   84 (139)
T PTZ00054         50 RLPSASLGDMVLATVKKGKPELRKKVLNAVIIRQR   84 (139)
T ss_pred             cCcccccCCEEEEEEEECCCcccCCEeeEEEEEEC
Confidence            35778899999999876553446699999999865


No 70 
>TIGR03673 rpl14p_arch 50S ribosomal protein L14P. Part of the 50S ribosomal subunit. Forms a cluster with proteins L3 and L24e, part of which may contact the 16S rRNA in 2 intersubunit bridges.
Probab=28.42  E-value=2e+02  Score=23.67  Aligned_cols=36  Identities=19%  Similarity=0.426  Sum_probs=27.6

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeec
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn  177 (201)
                      .+|.-.+||+|.|.++-.....|=|++.|+|+..+.
T Consensus        42 r~~~a~iGD~IvvsVK~~~p~~kg~v~kAVIVRtkk   77 (131)
T TIGR03673        42 RLPCAGVGDMVVVSVKKGTPEMRKQVFKAVVVRQRK   77 (131)
T ss_pred             cCCccccCCEEEEEEEECCccccCCEeEEEEEEeCc
Confidence            346778999999998864433455999999998764


No 71 
>PF04319 NifZ:  NifZ domain;  InterPro: IPR007415 NifZ is a short protein is found in the nif (nitrogen fixation) operon. It is required for the maturation of the nitrogenase MoFe protein. In the absence of NifZ, only one of the two P-clusters of the MoFe protein is matured to the ultimate [8Fe-7S] structure. The other P-cluster site in the protein contains a [4Fe-4S] cluster pair, suggesting that NifZ is specifically required for the formation of the second P-cluster [, , ].; GO: 0009399 nitrogen fixation
Probab=28.38  E-value=69  Score=24.18  Aligned_cols=34  Identities=18%  Similarity=0.269  Sum_probs=24.4

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeec
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn  177 (201)
                      |.|..||.|++.-.|..+-+=.-.=.|-+++++|
T Consensus         3 p~f~~G~~V~a~~~irNDGt~Pg~~~g~lLv~~G   36 (75)
T PF04319_consen    3 PRFEWGDKVRARKDIRNDGTFPGKEIGELLVRKG   36 (75)
T ss_pred             CccCCCCEEEEEEEeEcCCCCCCCCCCCEEEcCC
Confidence            8899999999999998743333333466666665


No 72 
>smart00316 S1 Ribosomal protein S1-like RNA-binding domain.
Probab=28.32  E-value=72  Score=20.33  Aligned_cols=16  Identities=25%  Similarity=0.455  Sum_probs=13.0

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .|++||+|++.+.-..
T Consensus        46 ~~~~G~~v~~~V~~~~   61 (72)
T smart00316       46 VLKVGDEVKVKVLSVD   61 (72)
T ss_pred             eecCCCEEEEEEEEEe
Confidence            4999999999876554


No 73 
>TIGR01956 NusG_myco NusG family protein. This model represents a family of Mycoplasma proteins orthologous to the bacterial transcription termination/antitermination factor NusG. These sequences from Mycoplasma are notably diverged (long branches in a Neighbor-joining phylogenetic tree) from the bacterial species. And although NusA and ribosomal protein S10 (NusE) appear to be present, NusB may be absent in Mycoplasmas calling into question whether these species have a functional Nus system including this family as a member.
Probab=28.06  E-value=1e+02  Score=28.11  Aligned_cols=30  Identities=17%  Similarity=0.214  Sum_probs=24.2

Q ss_pred             CCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeec
Q 028968          142 PIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn  177 (201)
                      ..++|.+||.|+|.-      .=++-|+|+|+...+
T Consensus       202 ~~~~f~vGd~VrI~d------GPF~GfeG~I~eid~  231 (258)
T TIGR01956       202 NLSKFRVGNFVKIVD------GPFKGIVGKIKKIDQ  231 (258)
T ss_pred             cccCCCCCCEEEEEe------cCCCCcEEEEEEEeC
Confidence            356799999999963      567889999999875


No 74 
>PF02014 Reeler:  Reeler domain Schematic picture including Reeler domain;  InterPro: IPR002861 Extracellular matrix (ECM) proteins play an important role in early cortical development, specifically in the formation of neural connections and in controlling the cyto-architecture of the central nervous system. The product of the reeler gene in mouse is reelin,a large extracellular protein secreted by pioneer neurons that coordinates cell positioning during neurodevelopment []. F-spondin and mindin are a family of matrix-attached adhesion molecules that share structural similarities and overlapping domains of expression. Both F-spondin and mindin promote adhesion and outgrowth of hippocampal embryonic neurons and bind to a putative receptor(s) expressed on both hippocampal and sensory neurons []. This domain of unknown function is found at the N terminus of reelin and F-spondin.; PDB: 2ZOT_B 2ZOU_B 3COO_A.
Probab=27.98  E-value=61  Score=25.11  Aligned_cols=33  Identities=15%  Similarity=0.358  Sum_probs=25.2

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCc
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGI  180 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi  180 (201)
                      ..+.+|++++|++    +...-+.|+|..|.-+...-
T Consensus        28 ~~y~pg~~~~Vtl----~~~~~~~F~GFllqAr~~~~   60 (132)
T PF02014_consen   28 SSYEPGQTYTVTL----SSSGSSSFRGFLLQARDANN   60 (132)
T ss_dssp             SSB-TTBEEEEEE----EETTTEEBSEEEEEEEETT-
T ss_pred             CeEcCCCEEEEEE----ECCCCCceeEEEEEEEeCCC
Confidence            3589999999999    55677889999998776543


No 75 
>PF11302 DUF3104:  Protein of unknown function (DUF3104);  InterPro: IPR021453  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=27.30  E-value=2.1e+02  Score=21.75  Aligned_cols=51  Identities=16%  Similarity=0.329  Sum_probs=34.7

Q ss_pred             CCCCCCCCEEEEEEEeec-CCcccceEEEEEEEeecCC----ccceEEEEeeeCCe
Q 028968          143 IPDIRTGDVVEIKLEVPE-NRRRLSIYKGIVMSRQNAG----IHTTIRIRRIIAGI  193 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~E-nKeRiQ~FeGIVIarrn~G----i~sTFTVRKIs~GV  193 (201)
                      +..+++||+|-|.-.-.- .+..-.=..|-||...|..    ..+-|-|-.+-.|+
T Consensus         3 FL~Vk~Gd~ViV~~~~~~~~~~~~dWWmg~Vi~~~ggaR~P~~~tlFQVadVDtG~   58 (75)
T PF11302_consen    3 FLSVKPGDTVIVQDEQEVGQKQDKDWWMGQVIHCEGGARDPKVPTLFQVADVDTGV   58 (75)
T ss_pred             ccccCCCCEEEEecCccccccCCCCcEEEEEEEEeccccCCCCCceEEEEEccCCe
Confidence            567899999998744311 2334466789999987654    34558887776664


No 76 
>PF00575 S1:  S1 RNA binding domain;  InterPro: IPR003029 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. The S1 domain was originally identified in ribosomal protein S1 but is found in a large number of RNA-associated proteins. The structure of the S1 RNA-binding domain from the Escherichia coli polynucleotide phosphorylase has been determined using NMR methods and consists of a five-stranded antiparallel beta barrel. Conserved residues on one face of the barrel and adjacent loops form the putative RNA-binding site [].  The structure of the S1 domain is very similar to that of cold shock proteins. This suggests that they may both be derived from an ancient nucleic acid-binding protein []. More information about these proteins can be found at Protein of the Month: RNA Exosomes []. This entry does not include translation initiation factor IF-1 S1 domains.; GO: 0003723 RNA binding; PDB: 3L7Z_F 2JE6_I 2JEA_I 2JEB_I 1E3P_A 2Y0S_E 1WI5_A 2BH8_A 2CQO_A 2EQS_A ....
Probab=27.17  E-value=69  Score=21.71  Aligned_cols=25  Identities=20%  Similarity=0.396  Sum_probs=18.2

Q ss_pred             CCCCCCCCCEEEEEEEeec-CCcccc
Q 028968          142 PIPDIRTGDVVEIKLEVPE-NRRRLS  166 (201)
Q Consensus       142 diPeFr~GDtVrV~v~I~E-nKeRiQ  166 (201)
                      .-..|++||+|+|.+.-.+ ++.|+.
T Consensus        45 ~~~~~~~G~~v~v~v~~vd~~~~~i~   70 (74)
T PF00575_consen   45 PSEVYKIGQTVRVKVIKVDKEKGRIR   70 (74)
T ss_dssp             SHGTCETTCEEEEEEEEEETTTTEEE
T ss_pred             cccccCCCCEEEEEEEEEECCCCeEE
Confidence            4457999999999887666 555543


No 77 
>PF03061 4HBT:  Thioesterase superfamily;  InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases. This family includes 4HBT (3.1.2.23 from EC) which catalyses the final step in the biosynthesis of 4-hydroxybenzoate from 4-chlorobenzoate in the soil dwelling microbe Pseudomonas CBS-3. This family includes various cytosolic long-chain acyl-CoA thioester hydrolases. Long-chain acyl-CoA hydrolases hydrolyse palmitoyl-CoA to CoA and palmitate, they also catalyse the hydrolysis of other long chain fatty acyl-CoA thioesters. ; PDB: 3F5O_F 2F0X_D 2H4U_C 2PRX_A 2OV9_D 1YLI_B 3BJK_F 1IXL_A 3DKZ_B 2EIS_B ....
Probab=27.17  E-value=1e+02  Score=20.28  Aligned_cols=28  Identities=21%  Similarity=0.268  Sum_probs=19.1

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEE
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIV  172 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIV  172 (201)
                      ..++||+|+++.++..-.++.-.++..+
T Consensus        43 p~~~gd~l~~~~~v~~~g~~~~~~~~~v   70 (79)
T PF03061_consen   43 PVRPGDTLRVEARVVRVGRKSFTVEVEV   70 (79)
T ss_dssp             -BBTTSEEEEEEEEEEEESSEEEEEEEE
T ss_pred             ccCCCeEEEEEEEEEEECCEEEEEEEEE
Confidence            4789999999999988444444444444


No 78 
>cd03452 MaoC_C MaoC_C  The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein. Orthologs of MaoC include PaaZ [Escherichia coli] and PaaN [Pseudomonas putida], which are putative ring-opening enzymes involved in phenylacetic acid degradation. The C-terminal domain of MaoC has sequence similarity to (R)-specific enoyl-CoA hydratase,Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  MaoC also has an N-terminal PutA domain like that found in the E. coli PutA proline dehydrogenase and other members of the aldehyde dehydrogenase family.
Probab=27.12  E-value=93  Score=24.27  Aligned_cols=15  Identities=20%  Similarity=0.600  Sum_probs=13.8

Q ss_pred             CCCCCEEEEEEEeec
Q 028968          146 IRTGDVVEIKLEVPE  160 (201)
Q Consensus       146 Fr~GDtVrV~v~I~E  160 (201)
                      .++||+|.+..+|.+
T Consensus        89 V~~GDtl~~~~~V~~  103 (142)
T cd03452          89 VYPGDTIQVRLTCKR  103 (142)
T ss_pred             CCCCCEEEEEEEEEE
Confidence            689999999999987


No 79 
>PF11717 Tudor-knot:  RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F ....
Probab=27.06  E-value=2e+02  Score=19.42  Aligned_cols=36  Identities=11%  Similarity=0.178  Sum_probs=25.9

Q ss_pred             CCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEE
Q 028968          146 IRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIR  187 (201)
Q Consensus       146 Fr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVR  187 (201)
                      |.+|+.|-+..      ..-+.|++.|+.++..+-..-|-|.
T Consensus         1 ~~vG~~v~~~~------~~~~~y~A~I~~~r~~~~~~~YyVH   36 (55)
T PF11717_consen    1 FEVGEKVLCKY------KDGQWYEAKILDIREKNGEPEYYVH   36 (55)
T ss_dssp             --TTEEEEEEE------TTTEEEEEEEEEEEECTTCEEEEEE
T ss_pred             CCcCCEEEEEE------CCCcEEEEEEEEEEecCCCEEEEEE
Confidence            67899888875      4568899999999987655555553


No 80 
>cd03440 hot_dog The hotdog fold was initially identified in the E. coli FabA (beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase) structure and subsequently in 4HBT (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A number of other seemingly unrelated proteins also share the hotdog fold.  These proteins have related, but distinct, catalytic activities that include metabolic roles such as thioester hydrolysis in fatty acid metabolism, and degradation of phenylacetic acid and the environmental pollutant 4-chlorobenzoate.  This superfamily also includes the PaaI-like protein FapR, a non-catalytic bacterial homolog involved in transcriptional regulation of fatty acid biosynthesis.
Probab=26.80  E-value=1.6e+02  Score=17.94  Aligned_cols=21  Identities=29%  Similarity=0.466  Sum_probs=15.7

Q ss_pred             CCCCCCCEEEEEEEeecCCcc
Q 028968          144 PDIRTGDVVEIKLEVPENRRR  164 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeR  164 (201)
                      -...+||.|.+..++.....+
T Consensus        56 ~~~~~g~~v~~~~~~~~~~~~   76 (100)
T cd03440          56 RPVRPGDTLTVEAEVVRVGRS   76 (100)
T ss_pred             cCCCCCCEEEEEEEEEecccc
Confidence            346679999999999883333


No 81 
>PRK12617 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed
Probab=26.70  E-value=1.9e+02  Score=25.16  Aligned_cols=47  Identities=17%  Similarity=0.169  Sum_probs=32.4

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCeee
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIGV  195 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVGV  195 (201)
                      +-++-||+|.|.+.-.-  =++ ..+|  .|..+++.+..+.|||...|-=|
T Consensus       154 ~lV~rG~~V~I~a~~~g--~~V-s~~G--~AL~~G~~Ge~IrVrN~~SgrvV  200 (214)
T PRK12617        154 RLVRRGDTVPLVSRNGG--LEV-RMSG--RALSDAGENERVSVENSSSRRVV  200 (214)
T ss_pred             ceEcCCCEEEEEEecCC--EEE-EEEE--EEccCCCCCCEEEEEECCCCCEE
Confidence            45899999999875321  111 1235  56778899999999997666433


No 82 
>PRK08515 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed
Probab=26.59  E-value=1.8e+02  Score=25.21  Aligned_cols=47  Identities=11%  Similarity=0.116  Sum_probs=33.0

Q ss_pred             CCCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCe
Q 028968          141 RPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGI  193 (201)
Q Consensus       141 kdiPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GV  193 (201)
                      +..|-++-||.|.|.+.-.-  =++ .++|  .|..++.++.+++||+ ..|-
T Consensus       161 ~~~~lV~rGd~V~i~~~~gg--~~I-~~~G--~Al~~G~~Gd~IrVrN-~Sgk  207 (222)
T PRK08515        161 KALILVRKNDIINGVLKEGG--VSI-EISL--KALQDGNLGDIIQAKN-KSNK  207 (222)
T ss_pred             CCcceEecCCEEEEEEECCC--EEE-EEEE--EEcccCCCCCEEEEEe-CCCC
Confidence            34677999999999875321  111 2344  6778889999999998 6553


No 83 
>PRK12618 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed
Probab=26.40  E-value=1.8e+02  Score=23.74  Aligned_cols=47  Identities=11%  Similarity=0.198  Sum_probs=32.4

Q ss_pred             CCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCee
Q 028968          143 IPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIG  194 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVG  194 (201)
                      -+-++-||.|.|.+...-  =++. -+|  .|..+++++.++.|||...|-=
T Consensus        79 p~lV~rG~~V~i~~~~gg--l~i~-~~G--~AL~~G~~Gd~IrV~N~~S~ri  125 (141)
T PRK12618         79 PAIVDRNQLVPLAYRLGG--LEIR-TEG--RALSRGGVGDEIRVMNLSSRTT  125 (141)
T ss_pred             ccEEeCCCEEEEEEecCC--EEEE-EEE--EEcccCCCCCEEEEEECCCCCE
Confidence            456899999999876431  1111 234  5667888999999999876643


No 84 
>cd01289 FabA_like Domain of unknown function, appears to be related to a diverse group of beta-hydroxydecanoyl ACP dehydratases (FabA) and beta-hydroxyacyl ACP dehydratases (FabZ). This group appears to lack the conserved active site histidine of FabA and FabZ.
Probab=26.25  E-value=91  Score=24.51  Aligned_cols=30  Identities=10%  Similarity=0.140  Sum_probs=22.7

Q ss_pred             CCCCCCCEEEEEEEeecCC-cccceEEEEEE
Q 028968          144 PDIRTGDVVEIKLEVPENR-RRLSIYKGIVM  173 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnK-eRiQ~FeGIVI  173 (201)
                      |-+.+||++.++++....+ +.+-.|+|.+.
T Consensus        91 ~v~p~Gd~l~i~~~~~~~~~~~~~~~~~~~~  121 (138)
T cd01289          91 DRFDLGSTLLIVVAELLQGDSGLGVFECTIE  121 (138)
T ss_pred             ceeCCCCeeEEEeeeeeeCCCcEEEEEEEEE
Confidence            4455699999999987755 47888887754


No 85 
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit.  Other enzymes with this fold include MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and 17-beta-hydroxysteriod dehydrogenase (HSD).
Probab=26.17  E-value=1.2e+02  Score=23.49  Aligned_cols=16  Identities=25%  Similarity=0.322  Sum_probs=14.1

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      ...+||+|++.+++.+
T Consensus        80 PV~~gdtl~~~~~v~~   95 (126)
T cd03447          80 MVLPNDELEVRLEHVG   95 (126)
T ss_pred             cCcCCCEEEEEEEEEE
Confidence            4679999999999987


No 86 
>TIGR02754 sod_Ni_protease nickel-type superoxide dismutase maturation protease. Members of this protein family are apparent proteases encoded adjacent to the genes for a nickel-type superoxide dismutase. This family belongs to the same larger family (see Pfam model pfam00717) as signal peptidase I, an unusual serine protease suggested to have a Ser/Lys catalytic dyad.
Probab=26.02  E-value=1.6e+02  Score=20.99  Aligned_cols=13  Identities=23%  Similarity=0.486  Sum_probs=11.1

Q ss_pred             CCCCCCCCEEEEE
Q 028968          143 IPDIRTGDVVEIK  155 (201)
Q Consensus       143 iPeFr~GDtVrV~  155 (201)
                      .|.|+.||.|-|.
T Consensus         9 ~P~l~~GD~vlv~   21 (90)
T TIGR02754         9 SPTLPPGDRIIVV   21 (90)
T ss_pred             cCccCCCCEEEEE
Confidence            4889999999776


No 87 
>cd04461 S1_Rrp5_repeat_hs8_sc7 S1_Rrp5_repeat_hs8_sc7: Rrp5 Homo sapiens S1 repeat 8 (hs8) and Saccharomyces cerevisiae S1 repeat 7 (sc7)-like domains. Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits.  Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in S. cerevisiae Rrp5 and 14 S1 repeats in H. sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 8 and S. cerevisiae S1 repeat 7. Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=25.95  E-value=84  Score=22.17  Aligned_cols=21  Identities=19%  Similarity=0.469  Sum_probs=14.4

Q ss_pred             CCCCCCEEEEEEEeec-CCccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRL  165 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRi  165 (201)
                      .|+.||+|+|.+.=.. .+.|+
T Consensus        58 ~~~~Gd~v~vkV~~id~~~~~i   79 (83)
T cd04461          58 GFKKGQSVTAKVTSVDEEKQRF   79 (83)
T ss_pred             hcCCCCEEEEEEEEEcCCCCEE
Confidence            3999999999875433 34444


No 88 
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein. This family represents an accessory protein that works with the bacteriocin maturation and ABC transport secretion protein described by TIGR01193.
Probab=25.94  E-value=1.3e+02  Score=28.09  Aligned_cols=46  Identities=24%  Similarity=0.294  Sum_probs=30.4

Q ss_pred             CCCCCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCc----cceEEEE
Q 028968          140 ERPIPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGI----HTTIRIR  187 (201)
Q Consensus       140 kkdiPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi----~sTFTVR  187 (201)
                      ..++..+++|+.|.|++.-  ...+-..|.|.|..+.....    +.+|+|+
T Consensus       366 e~di~~v~~Gq~V~v~~~a--~~~~~~~~~G~V~~Is~~~~~~~~~~~y~v~  415 (457)
T TIGR01000       366 SNDISGIKVGQKVRFKLTQ--NVPKPIILDGTITSISSAPTATKKGNFYKVI  415 (457)
T ss_pred             HHHHhhcCCCCeEEEEEec--CCCCceEEEEEEEEEcCCCccCCCCCEEEEE
Confidence            3567888899988777653  22233479999998875432    2467664


No 89 
>cd05691 S1_RPS1_repeat_ec6 S1_RPS1_repeat_ec6: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 6 (ec6) of the Escherichia coli RPS1. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=25.92  E-value=86  Score=20.93  Aligned_cols=16  Identities=31%  Similarity=0.493  Sum_probs=12.4

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .|++||+|++.+.=..
T Consensus        44 ~~~~Gd~v~~~v~~~d   59 (73)
T cd05691          44 RFKVGDEVEAKITNVD   59 (73)
T ss_pred             ccCCCCEEEEEEEEEe
Confidence            3899999999865443


No 90 
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  (R)-hydratase contains a hot-dog fold similar to those of thioesterase II, and beta-hydroxydecanoyl-ACP dehydratase, MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit.  The active site lies within a substrate-binding tunnel formed by the (R)-hydratase homodimer.  A subset of the bacterial (R)-hydratases contain a C-terminal phosphotransacetylase (PTA) domain.
Probab=25.92  E-value=1.6e+02  Score=21.41  Aligned_cols=16  Identities=31%  Similarity=0.445  Sum_probs=13.8

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .+.+||++.+..++.+
T Consensus        82 Pv~~gd~l~~~~~v~~   97 (128)
T cd03449          82 PVFIGDTVTATVTVTE   97 (128)
T ss_pred             CccCCCEEEEEEEEEE
Confidence            4688999999999887


No 91 
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional
Probab=25.80  E-value=1.3e+02  Score=24.42  Aligned_cols=16  Identities=25%  Similarity=0.252  Sum_probs=14.2

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .+++||+|.+.++|.+
T Consensus        96 PV~~GDtL~~~~eV~~  111 (159)
T PRK13692         96 PIVAGDKLYCDVYVDS  111 (159)
T ss_pred             CccCCCEEEEEEEEEE
Confidence            4899999999999976


No 92 
>TIGR00074 hypC_hupF hydrogenase assembly chaperone HypC/HupF. An additional proposed function is to shuttle the iron atom that has been liganded at the HypC/HypD complex to the precursor of the large hydrogenase (HycE) subunit. PubMed:12441107.
Probab=25.71  E-value=51  Score=24.61  Aligned_cols=15  Identities=20%  Similarity=0.567  Sum_probs=13.0

Q ss_pred             CCCCCCCCEEEEEEE
Q 028968          143 IPDIRTGDVVEIKLE  157 (201)
Q Consensus       143 iPeFr~GDtVrV~v~  157 (201)
                      +|+.++||.|-||.=
T Consensus        33 v~~~~vGD~VLVH~G   47 (76)
T TIGR00074        33 VGEVKVGDYVLVHVG   47 (76)
T ss_pred             eCCCCCCCEEEEecC
Confidence            478999999999973


No 93 
>PF01575 MaoC_dehydratas:  MaoC like domain;  InterPro: IPR002539 The C terminus of the MaoC protein is found to share similarity with a wide variety of enzymes. All these enzymes contain multiple domains. This domain is found in parts of two enzymes that have been assigned dehydratase activities. A deletion mutant of the C-terminal 271 amino acids in Q02207 from SWISSPROT abolished its 2-enoyl-CoA hydratase activity, suggesting that this region may be a hydratase enzyme []. The maoC gene is part of a operon with maoA which is involved in the synthesis of monoamine oxidase [].; GO: 0016491 oxidoreductase activity, 0008152 metabolic process; PDB: 3HMJ_H 2UV8_I 2VKZ_G 1PN4_C 1PN2_B 1S9C_K 3OML_A 1Q6W_B 2B3M_A 3K67_B ....
Probab=25.64  E-value=75  Score=23.93  Aligned_cols=28  Identities=21%  Similarity=0.285  Sum_probs=17.8

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEE
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGI  171 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGI  171 (201)
                      -...+||+|.+.+++.+.+..-+...+.
T Consensus        87 ~PV~~gdtl~~~~~v~~~~~~~~~~~v~  114 (122)
T PF01575_consen   87 APVFPGDTLTAEVEVTEKREGKERVRVT  114 (122)
T ss_dssp             S--BTTEEEEEEEEEEEEEEEEEEEEEE
T ss_pred             ccccCCCEEEEEEEEEEEEEcCceEEEE
Confidence            4588999999999998833333444333


No 94 
>KOG0494 consensus Transcription factor CHX10 and related HOX domain proteins [General function prediction only]
Probab=25.33  E-value=14  Score=34.49  Aligned_cols=68  Identities=24%  Similarity=0.332  Sum_probs=46.1

Q ss_pred             ecccccccchhhhccC-CCCCCCchhHHHHHHHHHHHHhhhcCCCCCCCCCCCEEEEEEEeecCCcccceE
Q 028968           99 VEAESEDKVEEEEVKA-PRKPRVKLGDIMGILNKRAVEASESERPIPDIRTGDVVEIKLEVPENRRRLSIY  168 (201)
Q Consensus        99 ~e~~~~~~~e~~~~~p-~r~~~~klg~lM~iLnke~IE~~q~kkdiPeFr~GDtVrV~v~I~EnKeRiQ~F  168 (201)
                      +-++.++-.-.-.... .+++|.....+...+..+++|+.++..-+||++.-..+.+..+++|  .|||++
T Consensus       120 ~g~~~ln~~~~s~~~~kkk~kRRh~RTiFT~~Qle~LEkaFkeaHYPDv~Are~la~ktelpE--DRIqVW  188 (332)
T KOG0494|consen  120 VGGESLNGSGGSPDNAKKKKKRRHFRTIFTSYQLEELEKAFKEAHYPDVYAREMLADKTELPE--DRIQVW  188 (332)
T ss_pred             cCCccccCCCCCCcccccccccccccchhhHHHHHHHHHHHhhccCccHHHHHHHhhhccCch--hhhhHH
Confidence            3445555433322222 2234444566776666689999988889999999999999999988  577764


No 95 
>PRK09014 rfaH transcriptional activator RfaH; Provisional
Probab=25.23  E-value=83  Score=25.15  Aligned_cols=27  Identities=19%  Similarity=0.199  Sum_probs=22.4

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn  177 (201)
                      .|.+||.|+|.      ..-++-|+|+|....+
T Consensus       109 ~~~~G~~V~I~------~Gp~~g~eg~v~~~~~  135 (162)
T PRK09014        109 TPKPGDKVIIT------EGAFEGLQAIYTEPDG  135 (162)
T ss_pred             CCCCCCEEEEe------cCCCCCcEEEEEEeCC
Confidence            58999999995      3568899999988764


No 96 
>PF08605 Rad9_Rad53_bind:  Fungal Rad9-like Rad53-binding;  InterPro: IPR013914  In Saccharomyces cerevisiae (Baker s yeast), the Rad9 is a key adaptor protein in DNA damage checkpoint pathways. DNA damage induces Rad9 phosphorylation, and Rad53 specifically associates with this region of Rad9, when phosphorylated, via the Rad53 IPR000253 from INTERPRO domain []. There is no clear higher eukaryotic ortholog to Rad9. 
Probab=24.85  E-value=38  Score=27.68  Aligned_cols=14  Identities=36%  Similarity=0.565  Sum_probs=11.7

Q ss_pred             CCCCCCCCEEEEEE
Q 028968          143 IPDIRTGDVVEIKL  156 (201)
Q Consensus       143 iPeFr~GDtVrV~v  156 (201)
                      .-++|+||+|+|..
T Consensus        57 ~LDlRIGD~Vkv~~   70 (131)
T PF08605_consen   57 YLDLRIGDTVKVDG   70 (131)
T ss_pred             eeeeecCCEEEECC
Confidence            35799999999975


No 97 
>PF12148 DUF3590:  Protein of unknown function (DUF3590);  InterPro: IPR021991  This domain is found in eukaryotes, and is typically between 83 and 97 amino acids in length. It is found in association with PF00097 from PFAM, PF02182 from PFAM, PF00628 from PFAM, PF00240 from PFAM. There are two conserved sequence motifs: RAR and NYN. The domain is part of the protein NIRF which has zinc finger and ubiquitinating domains. The function of this domain is likely to be mainly structural, however this has not been confirmed. ; PDB: 3DB4_A 3ASK_A 3DB3_A 2L3R_A.
Probab=24.47  E-value=44  Score=25.82  Aligned_cols=22  Identities=27%  Similarity=0.546  Sum_probs=14.3

Q ss_pred             CCCCCCCCEEEEEEEeecCCcc
Q 028968          143 IPDIRTGDVVEIKLEVPENRRR  164 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~EnKeR  164 (201)
                      .-++.+|+.|-|++.+.+.|+|
T Consensus        63 w~~L~VG~~VMvNYN~d~P~er   84 (85)
T PF12148_consen   63 WDELKVGQVVMVNYNVDEPKER   84 (85)
T ss_dssp             GGG--TT-EEEEEE-TTSTTS-
T ss_pred             HHhCCcccEEEEecCCCCcccC
Confidence            4468899999999999887776


No 98 
>TIGR01955 RfaH transcriptional activator RfaH. This model represents the transcriptional activator protein, RfaH. This protein is most closely related to the transcriptional termination/antitermination protein NusG (TIGR00922) and contains the KOW motif (pfam00467). This protein appears to be limited to the gamma proteobacteria. In E. coli, this gene appears to control the expression of haemolysin, sex factor and lipopolysaccharide genes.
Probab=24.18  E-value=1.1e+02  Score=24.12  Aligned_cols=29  Identities=17%  Similarity=0.235  Sum_probs=22.7

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeecC
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNA  178 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~  178 (201)
                      ..|.+||.|+|.      ..=++-|+|+|....++
T Consensus       107 ~~~~~G~~V~V~------~GPf~g~~g~v~~~~~~  135 (159)
T TIGR01955       107 TLPYKGDKVRIT------DGAFAGFEAIFLEPDGE  135 (159)
T ss_pred             cCCCCCCEEEEe------ccCCCCcEEEEEEECCC
Confidence            459999999885      24478899999998743


No 99 
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=24.03  E-value=46  Score=31.38  Aligned_cols=15  Identities=40%  Similarity=0.857  Sum_probs=13.0

Q ss_pred             CCCCCCCCCEEEEEE
Q 028968          142 PIPDIRTGDVVEIKL  156 (201)
Q Consensus       142 diPeFr~GDtVrV~v  156 (201)
                      -||+|++||+|.+.-
T Consensus       243 rip~~~~gDiV~~~~  257 (355)
T COG1499         243 RIPEFRPGDIVSVRG  257 (355)
T ss_pred             ECCCCCCCCEEEECC
Confidence            389999999999863


No 100
>PF11325 DUF3127:  Domain of unknown function (DUF3127);  InterPro: IPR021474  This bacterial family of proteins has no known function. 
Probab=23.93  E-value=73  Score=24.37  Aligned_cols=18  Identities=17%  Similarity=0.532  Sum_probs=15.0

Q ss_pred             CCCCCCCCEEEEEEEeec
Q 028968          143 IPDIRTGDVVEIKLEVPE  160 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~E  160 (201)
                      +-.|++||.|+|.+.|.-
T Consensus        50 l~~~~~Gd~V~Vsf~i~~   67 (84)
T PF11325_consen   50 LDNFQVGDEVKVSFNIEG   67 (84)
T ss_pred             hccCCCCCEEEEEEEeec
Confidence            367999999999998853


No 101
>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis]
Probab=23.79  E-value=58  Score=24.61  Aligned_cols=27  Identities=26%  Similarity=0.356  Sum_probs=18.6

Q ss_pred             cCCCCCCCCCCCEEEEEEEeec-CCccc
Q 028968          139 SERPIPDIRTGDVVEIKLEVPE-NRRRL  165 (201)
Q Consensus       139 ~kkdiPeFr~GDtVrV~v~I~E-nKeRi  165 (201)
                      +++.---+.+||.|.|.+.--. +|-|+
T Consensus        40 mr~~~i~I~~GD~V~Ve~~~~d~~kg~I   67 (75)
T COG0361          40 MRKNRIRILPGDVVLVELSPYDLTKGRI   67 (75)
T ss_pred             chheeEEeCCCCEEEEEecccccccccE
Confidence            3444456899999999987655 55443


No 102
>cd04486 YhcR_OBF_like YhcR_OBF_like: A subfamily of OB-fold domains similar to the OB folds of Bacillus subtilis YhcR. YhcR is a sugar-nonspecific nuclease, which is active in the presence of Ca2+ and Mn2+. It cleaves RNA endonucleolytically, producing 3'-monophosphate nucleosides. YhcR appears to be the major Ca2+ activated nuclease of B. subtilis. YhcR may be localized in the cell wall.
Probab=23.66  E-value=95  Score=22.66  Aligned_cols=24  Identities=25%  Similarity=0.254  Sum_probs=18.6

Q ss_pred             CCCCCCCCEEEEEEEeecCCcccc
Q 028968          143 IPDIRTGDVVEIKLEVPENRRRLS  166 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~EnKeRiQ  166 (201)
                      .+.+.+||.|+|.=++.|-...+|
T Consensus        42 ~~~~~~Gd~V~vtG~v~ey~g~tq   65 (78)
T cd04486          42 GADVAVGDLVRVTGTVTEYYGLTQ   65 (78)
T ss_pred             CCCCCCCCEEEEEEEEEeeCCeEE
Confidence            678999999999988888333444


No 103
>cd05696 S1_Rrp5_repeat_hs4 S1_Rrp5_repeat_hs4: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 4 (hs4). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=23.49  E-value=99  Score=21.54  Aligned_cols=21  Identities=10%  Similarity=0.058  Sum_probs=15.0

Q ss_pred             CCCCCCEEEEEEEeec-CCccc
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRL  165 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRi  165 (201)
                      .|++||.|++.+.-.. .+.|+
T Consensus        46 ~~~vG~~v~~kV~~id~~~~~i   67 (71)
T cd05696          46 PFKAGTTHKARIIGYSPMDGLL   67 (71)
T ss_pred             ccCCCCEEEEEEEEEeCCCCEE
Confidence            3999999999976544 33344


No 104
>PF14326 DUF4384:  Domain of unknown function (DUF4384)
Probab=23.28  E-value=78  Score=22.87  Aligned_cols=17  Identities=18%  Similarity=0.319  Sum_probs=14.0

Q ss_pred             CCCCCCCEEEEEEEeec
Q 028968          144 PDIRTGDVVEIKLEVPE  160 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~E  160 (201)
                      |.|+.||.|++.++..+
T Consensus         1 ~~~~~Ge~v~~~~~~~~   17 (83)
T PF14326_consen    1 TVYRVGERVRFRVTSNR   17 (83)
T ss_pred             CcccCCCEEEEEEEeCC
Confidence            56899999999988743


No 105
>cd05687 S1_RPS1_repeat_ec1_hs1 S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 1 of the Escherichia coli and Homo sapiens RPS1 (ec1 and hs1, respectively). Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=23.27  E-value=1.1e+02  Score=20.68  Aligned_cols=15  Identities=33%  Similarity=0.490  Sum_probs=12.3

Q ss_pred             CCCCCEEEEEEEeec
Q 028968          146 IRTGDVVEIKLEVPE  160 (201)
Q Consensus       146 Fr~GDtVrV~v~I~E  160 (201)
                      |++||.|++.+.-..
T Consensus        45 ~~~Gd~i~~~i~~~~   59 (70)
T cd05687          45 VKVGDEVEVYVLRVE   59 (70)
T ss_pred             CCCCCEEEEEEEEEE
Confidence            999999999876543


No 106
>smart00276 GLECT Galectin. Galectin - galactose-binding lectin
Probab=23.04  E-value=1.1e+02  Score=23.64  Aligned_cols=50  Identities=18%  Similarity=0.294  Sum_probs=29.3

Q ss_pred             CCCC-CCCCCCEEEEEEEeecCCcccc--eEEEE-EEEe-ecCCccceEEEEeee
Q 028968          141 RPIP-DIRTGDVVEIKLEVPENRRRLS--IYKGI-VMSR-QNAGIHTTIRIRRII  190 (201)
Q Consensus       141 kdiP-eFr~GDtVrV~v~I~EnKeRiQ--~FeGI-VIar-rn~Gi~sTFTVRKIs  190 (201)
                      ..|| .|++|++|.|+=++..+.+|.+  ...|- -|+- =|--.+....|||-.
T Consensus         3 ~~lp~~l~~G~~i~i~G~~~~~~~~F~inl~~~~~di~lH~n~rf~~~~iV~Ns~   57 (128)
T smart00276        3 LPIPGGLKPGQTLTVRGIVLPDAKRFSINLLTGGDDIALHFNPRFNENKIVCNSK   57 (128)
T ss_pred             ccCCCCCCCCCEEEEEEEECCCCCEEEEEeecCCCCEEEEEeccCCCCEEEEeCc
Confidence            3577 7999999999999987544443  33331 1111 112233456677754


No 107
>PRK12442 translation initiation factor IF-1; Reviewed
Probab=23.01  E-value=60  Score=25.28  Aligned_cols=24  Identities=21%  Similarity=0.273  Sum_probs=17.4

Q ss_pred             cCCCCCCCCCCCEEEEEEEeec-CC
Q 028968          139 SERPIPDIRTGDVVEIKLEVPE-NR  162 (201)
Q Consensus       139 ~kkdiPeFr~GDtVrV~v~I~E-nK  162 (201)
                      +++..-.+.+||.|.|.+.--. +|
T Consensus        40 mR~~rIrIl~GD~V~VE~spYDltk   64 (87)
T PRK12442         40 MRKHRIRILAGDRVTLELSPYDLTK   64 (87)
T ss_pred             eeeeeEEecCCCEEEEEECcccCCc
Confidence            4455566899999999987544 44


No 108
>PF04225 OapA:  Opacity-associated protein A LysM-like domain;  InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein. This protein is required for efficient nasopharyngeal mucosal colonization, and its expression is associated with a distinctive transparent colony phenotype. OapA is thought to be a secreted protein, and its expression exhibits high-frequency phase variation [].; PDB: 2GU1_A.
Probab=22.46  E-value=1.1e+02  Score=22.89  Aligned_cols=19  Identities=21%  Similarity=0.716  Sum_probs=10.7

Q ss_pred             cCCCCCCCCCCCEEEEEEE
Q 028968          139 SERPIPDIRTGDVVEIKLE  157 (201)
Q Consensus       139 ~kkdiPeFr~GDtVrV~v~  157 (201)
                      ..+.+-.++|||+|.+.+.
T Consensus        36 ~~k~L~~L~pGq~l~f~~d   54 (85)
T PF04225_consen   36 EAKPLTRLKPGQTLEFQLD   54 (85)
T ss_dssp             GT--GGG--TT-EEEEEE-
T ss_pred             ccchHhhCCCCCEEEEEEC
Confidence            3467888999999998864


No 109
>KOG3416 consensus Predicted nucleic acid binding protein [General function prediction only]
Probab=22.30  E-value=1e+02  Score=25.84  Aligned_cols=29  Identities=24%  Similarity=0.439  Sum_probs=20.0

Q ss_pred             CCCCCCEEEEEEEeecCCcccceEEEEEEEeecCC
Q 028968          145 DIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAG  179 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~G  179 (201)
                      -|+|||+|+++      +.=..+|+|-.+-.-|+|
T Consensus        61 ~~~PGDIirLt------~Gy~Si~qg~LtL~~GK~   89 (134)
T KOG3416|consen   61 LIQPGDIIRLT------GGYASIFQGCLTLYVGKG   89 (134)
T ss_pred             ccCCccEEEec------ccchhhhcCceEEEecCC
Confidence            38999999984      556778888444444544


No 110
>cd00070 GLECT Galectin/galactose-binding lectin. This domain exclusively binds beta-galactosides, such as lactose, and does not require metal ions for activity. GLECT domains occur as homodimers or tandemly repeated domains. They are developmentally regulated and may be involved in differentiation, cell-cell interaction and cellular regulation.
Probab=22.24  E-value=1.2e+02  Score=23.32  Aligned_cols=25  Identities=28%  Similarity=0.611  Sum_probs=19.7

Q ss_pred             CCCC-CCCCCCEEEEEEEeecCCccc
Q 028968          141 RPIP-DIRTGDVVEIKLEVPENRRRL  165 (201)
Q Consensus       141 kdiP-eFr~GDtVrV~v~I~EnKeRi  165 (201)
                      ..+| .|++|+.|.|+-.+..+.+|.
T Consensus         4 ~~l~~~l~~G~~i~i~G~~~~~~~~f   29 (127)
T cd00070           4 LPLPGGLKPGSTLTVKGRVLPNAKRF   29 (127)
T ss_pred             cccCCCCcCCCEEEEEEEECCCCCEE
Confidence            3566 799999999999998854443


No 111
>PF01052 SpoA:  Surface presentation of antigens (SPOA);  InterPro: IPR001543 Proteins in this group are involved in a secretory pathway responsible for the surface presentation of invasion plasmid antigen needed for the entry of Salmonella and other species into mammalian cells [, ].They could play a role in preserving the translocation competence of the IPA antigens and are required for secretion of the three IPA proteins [].  The C-terminal region of flagellar motor switch proteins FliN and FliM is also included in this entry. ; PDB: 3UEP_A 1O9Y_B 1YAB_A.
Probab=21.94  E-value=66  Score=22.59  Aligned_cols=35  Identities=17%  Similarity=0.368  Sum_probs=21.5

Q ss_pred             CCCCCCCCEEEEEEEeec----CCcccceEEEEEEEeec
Q 028968          143 IPDIRTGDVVEIKLEVPE----NRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~E----nKeRiQ~FeGIVIarrn  177 (201)
                      +=.+++||++.+.....+    .-.-...|.|......+
T Consensus        26 l~~L~~Gdvi~l~~~~~~~v~l~v~g~~~~~g~lg~~~~   64 (77)
T PF01052_consen   26 LLNLKVGDVIPLDKPADEPVELRVNGQPIFRGELGRVNG   64 (77)
T ss_dssp             HHC--TT-EEEECCESSTEEEEEETTEEEEEEEEEEETT
T ss_pred             HhcCCCCCEEEeCCCCCCCEEEEECCEEEEEEEEEEECC
Confidence            446889999988777433    23556788888876554


No 112
>PRK10800 acyl-CoA thioesterase YbgC; Provisional
Probab=21.94  E-value=1.6e+02  Score=22.01  Aligned_cols=27  Identities=19%  Similarity=0.341  Sum_probs=20.3

Q ss_pred             CCCCCCCEEEEEEEeec-CCcccceEEE
Q 028968          144 PDIRTGDVVEIKLEVPE-NRRRLSIYKG  170 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~E-nKeRiQ~FeG  170 (201)
                      -..+.||+|.|+..+.+ ++.++....-
T Consensus        65 ~~~~~~d~i~v~t~v~~~~~~s~~~~~~   92 (130)
T PRK10800         65 APARLDDMLEVQSEITSMRGTSLTFTQR   92 (130)
T ss_pred             CcccCCCEEEEEEEEEeeCcEEEEEEEE
Confidence            35678999999999999 7666554433


No 113
>cd05692 S1_RPS1_repeat_hs4 S1_RPS1_repeat_hs4: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of 4-6 tandem S1 domains. In some bacteria, the tandem S1 array is located C-terminal to a 4-hydroxy-3-methylbut-2-enyl diphosphate reductase (HMBPP reductase) domain. While RPS1 is found primarily in bacteria, proteins with tandem RPS1-like domains have been identified in plants and humans, however these lack the N-terminal HMBPP reductase domain. This CD includes S1 repeat 4 (hs4) of the H. sapiens RPS1 homolog. Autoantibodies to double-stranded DNA from patients with systemic lupus erythematosus cross-react with the human RPS1 homolog.
Probab=21.60  E-value=1.3e+02  Score=19.35  Aligned_cols=13  Identities=31%  Similarity=0.565  Sum_probs=10.9

Q ss_pred             CCCCCCEEEEEEE
Q 028968          145 DIRTGDVVEIKLE  157 (201)
Q Consensus       145 eFr~GDtVrV~v~  157 (201)
                      .|++||.|+|.+.
T Consensus        44 ~~~~Gd~v~v~v~   56 (69)
T cd05692          44 VLKEGDKVKVKVL   56 (69)
T ss_pred             ccCCCCEEEEEEE
Confidence            4899999999864


No 114
>PRK06804 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed
Probab=21.34  E-value=2.2e+02  Score=25.68  Aligned_cols=47  Identities=13%  Similarity=0.112  Sum_probs=32.5

Q ss_pred             CCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCee
Q 028968          143 IPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIG  194 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVG  194 (201)
                      -+-++-||.|.|.+.-.-  =++ ..+|  +|..+++.+.++.|||...|-=
T Consensus       200 p~lV~rG~~V~Iva~~gg--~~i-~~~G--~AL~~G~~Gd~IrVrN~~Sgkv  246 (261)
T PRK06804        200 PVLVERGQHVLMIAAQDG--IEA-QTLG--IAQKNGRKGELIKVKNLSSGRV  246 (261)
T ss_pred             CcEEecCCEEEEEEecCC--EEE-EEEE--EEccCCCCCCEEEEEECCCCCE
Confidence            456899999999875321  111 1234  6777889999999999776643


No 115
>cd03446 MaoC_like MoaC_like    Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain. This protein family has a hot-dog fold similar to that of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.
Probab=21.25  E-value=1.5e+02  Score=22.22  Aligned_cols=16  Identities=31%  Similarity=0.447  Sum_probs=14.2

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .+++||+|.+..+|.+
T Consensus        90 pv~~GD~l~~~~~v~~  105 (140)
T cd03446          90 PVFIGDTIRAEAEVVE  105 (140)
T ss_pred             CCCCCCEEEEEEEEEE
Confidence            3789999999999986


No 116
>TIGR02799 thio_ybgC tol-pal system-associated acyl-CoA thioesterase. The tol-pal system consists of five critical genes. Inner membrane proteins TolQ and TolR convert protomotive force to energy that is transduced through TolA to an outer membrane complex of TolB and Pal. The system is known to be required to maintain outer membrane integrity. In a system with several homologous parts, ExbB and ExbD transduces energy through TonB to a variety of outer membrane proteins, many of which are siderophore receptors. The tol-pal system therefore may also be involved in transport. This family consists of a protein nearly always found in operons with the genes of the tol-pal system. The significance of this thioesterase to the tol-pal system is unclear, but either of two observations may be relevant. First, Pal, or peptidoglycan-associated lipoprotein, has a conserved N-terminal cleavage and acylation that makes it a lipoprotein. Second, the tol-pal system is implicated not only in the import o
Probab=21.23  E-value=1.7e+02  Score=21.30  Aligned_cols=28  Identities=18%  Similarity=0.243  Sum_probs=21.9

Q ss_pred             CCCCCCEEEEEEEeec-CCcccceEEEEE
Q 028968          145 DIRTGDVVEIKLEVPE-NRRRLSIYKGIV  172 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E-nKeRiQ~FeGIV  172 (201)
                      ..+.||+|.|+..+.+ ++.+......+.
T Consensus        65 ~~~~gd~v~v~~~v~~~~~~~~~~~~~i~   93 (126)
T TIGR02799        65 PARLDDLLTVTTRVVELKGASLVFAQEVR   93 (126)
T ss_pred             cccCCCEEEEEEEEEecCceEEEEEEEEE
Confidence            5678999999999999 777777654444


No 117
>cd05693 S1_Rrp5_repeat_hs1_sc1 S1_Rrp5_repeat_hs1_sc1: Rrp5 is a trans-acting factor important for biogenesis of both the 40S and 60S eukaryotic ribosomal subunits. Rrp5 has two distinct regions, an N-terminal region containing tandemly repeated S1 RNA-binding domains (12 S1 repeats in Saccharomyces cerevisiae Rrp5 and 14 S1 repeats in Homo sapiens Rrp5) and a C-terminal region containing tetratricopeptide repeat (TPR) motifs thought to be involved in protein-protein interactions. Mutational studies have shown that each region represents a specific functional domain. Deletions within the S1-containing region inhibit pre-rRNA processing at either site A3 or A2, whereas deletions within the TPR region confer an inability to support cleavage of A0-A2. This CD includes H. sapiens S1 repeat 1 (hs1) and S. cerevisiae S1 repeat 1 (sc1). Rrp5 is found in eukaryotes but not in prokaryotes or archaea.
Probab=20.67  E-value=1.1e+02  Score=23.26  Aligned_cols=16  Identities=19%  Similarity=0.237  Sum_probs=13.1

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .|++||+|++.+.-..
T Consensus        66 ~f~vGd~V~~kVi~~d   81 (100)
T cd05693          66 LFSVGQLVRCKVVSLD   81 (100)
T ss_pred             hccCCCEEEEEEEEcc
Confidence            4999999999876554


No 118
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional
Probab=20.64  E-value=1.3e+02  Score=24.83  Aligned_cols=16  Identities=13%  Similarity=0.366  Sum_probs=14.3

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      .+++||+|.+.++|.+
T Consensus        96 PV~~GDtL~~~~~V~~  111 (166)
T PRK13691         96 PVLAGDKLWARMDIHS  111 (166)
T ss_pred             CcCCCCEEEEEEEEEE
Confidence            3799999999999976


No 119
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  The alpha- and gamma-proteobacterial members of this CD have, in addition to a hot dog fold, an N-terminal extension.
Probab=20.62  E-value=1.9e+02  Score=21.68  Aligned_cols=16  Identities=19%  Similarity=0.289  Sum_probs=14.2

Q ss_pred             CCCCCCEEEEEEEeec
Q 028968          145 DIRTGDVVEIKLEVPE  160 (201)
Q Consensus       145 eFr~GDtVrV~v~I~E  160 (201)
                      ...+||+|.+..+|.+
T Consensus        79 pv~~Gdtl~~~~~v~~   94 (123)
T cd03455          79 PLYAGDTLRFGGRVTA   94 (123)
T ss_pred             cccCCCEEEEEEEEEe
Confidence            4689999999999987


No 120
>CHL00057 rpl14 ribosomal protein L14
Probab=20.56  E-value=1.9e+02  Score=23.40  Aligned_cols=34  Identities=12%  Similarity=0.198  Sum_probs=26.0

Q ss_pred             CCCCCCCEEEEEEEeec--C-CcccceEEEEEEEeec
Q 028968          144 PDIRTGDVVEIKLEVPE--N-RRRLSIYKGIVMSRQN  177 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~E--n-KeRiQ~FeGIVIarrn  177 (201)
                      +.-.+||+|.|.++-..  . -.|=|++.++|+..+.
T Consensus        31 ~~a~vGD~IvvsVk~~~~~~k~kkg~v~kAvIVrtk~   67 (122)
T CHL00057         31 KYAHIGDVIIAVVKEAVPNMPLKRSEVVRAVIVRTCK   67 (122)
T ss_pred             ccccCCCEEEEEEEeccCCCceecCCEEEEEEEEecc
Confidence            56789999999887533  2 3467999999998764


No 121
>PRK11281 hypothetical protein; Provisional
Probab=20.52  E-value=2.1e+02  Score=31.06  Aligned_cols=36  Identities=19%  Similarity=0.249  Sum_probs=23.7

Q ss_pred             CCCCCCEEEEEEE---eec---CCcccceEEEEEEEeecCCc
Q 028968          145 DIRTGDVVEIKLE---VPE---NRRRLSIYKGIVMSRQNAGI  180 (201)
Q Consensus       145 eFr~GDtVrV~v~---I~E---nKeRiQ~FeGIVIarrn~Gi  180 (201)
                      .|++||+|+|.=.   |.+   --+|+..+.|..|-+-|+-+
T Consensus       938 PfrIGD~I~I~~~~G~V~~I~lRsT~Irt~D~~~ViIPNs~~  979 (1113)
T PRK11281        938 PVRIGDTVTIGTFSGTVSKIRIRATTITDFDRKEVIVPNKAF  979 (1113)
T ss_pred             CcCCCCEEEECCEEEEEEEEEeEEEEEEcCCCCEEEEechhh
Confidence            4999999998521   222   24667777777777766654


No 122
>PF01455 HupF_HypC:  HupF/HypC family;  InterPro: IPR001109 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesised as a precursor devoid of the metalloenzyme active site. This precursor then undergoes a complex post-translational maturation process that requires a number of accessory proteins. The hydrogenase expression/formation proteins (HupF/HypC) form a family of small proteins that are hydrogenase precursor-specific chaperones required for this maturation process []. They are believed to keep the hydrogenase precursor in a conformation accessible for metal incorporation [, ].; PDB: 3D3R_A 2Z1C_C 2OT2_A.
Probab=20.47  E-value=77  Score=22.98  Aligned_cols=14  Identities=36%  Similarity=0.821  Sum_probs=10.5

Q ss_pred             CCCCCCCCEEEEEE
Q 028968          143 IPDIRTGDVVEIKL  156 (201)
Q Consensus       143 iPeFr~GDtVrV~v  156 (201)
                      +|+..+||.|-||.
T Consensus        35 v~~v~~Gd~VLVHa   48 (68)
T PF01455_consen   35 VPDVKVGDYVLVHA   48 (68)
T ss_dssp             CTSB-TT-EEEEET
T ss_pred             eCCCCCCCEEEEec
Confidence            68899999999984


No 123
>TIGR00922 nusG transcription termination/antitermination factor NusG. Archaeal proteins once termed NusG share the KOW domain but are actually a ribosomal protein corresponding to L24p in bacterial and L26e in eukaryotes (TIGR00405).
Probab=20.37  E-value=4.5e+02  Score=21.00  Aligned_cols=28  Identities=18%  Similarity=0.328  Sum_probs=22.5

Q ss_pred             CCCCCCCEEEEEEEeecCCcccceEEEEEEEeec
Q 028968          144 PDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQN  177 (201)
Q Consensus       144 PeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn  177 (201)
                      ..|++||.|+|.      ..=++-|+|+|+...+
T Consensus       118 ~~~~~G~~V~I~------~Gpf~G~~g~v~~~~~  145 (172)
T TIGR00922       118 IDFEVGEQVRVN------DGPFANFTGTVEEVDY  145 (172)
T ss_pred             cCCCCCCEEEEe------ecCCCCcEEEEEEEcC
Confidence            559999999995      3567788999998764


No 124
>COG5496 Predicted thioesterase [General function prediction only]
Probab=20.36  E-value=2.5e+02  Score=23.42  Aligned_cols=47  Identities=19%  Similarity=0.210  Sum_probs=27.5

Q ss_pred             CCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeee
Q 028968          143 IPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRII  190 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs  190 (201)
                      +-..-+|++|+|..++.+-..|--.|.+++. --+.-|++--+.|.|.
T Consensus        68 la~~~~G~~V~i~~~l~~v~Gr~v~f~i~a~-~~~~~Ig~g~h~R~iv  114 (130)
T COG5496          68 LAATPPGLTVTIGARLEKVEGRKVKFRIIAM-EGGDKIGEGTHTRVIV  114 (130)
T ss_pred             ccCCCCCCeEEEEEEEEEEeccEEEEEEEEe-eCCcEEeeeEEEEEEe
Confidence            3456799999999999883333345666554 1122234444445443


No 125
>PF01281 Ribosomal_L9_N:  Ribosomal protein L9, N-terminal domain;  InterPro: IPR020070 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. Ribosomal protein L9 is one of the proteins from the large ribosomal subunit. In Escherichia coli, L9 is known to bind directly to the 23S rRNA. It belongs to a family of ribosomal proteins grouped on the basis of sequence similarities [, ].  The crystal structure of Bacillus stearothermophilus L9 shows the 149-residue protein comprises two globular domains connected by a rigid linker []. Each domain contains an rRNA binding site, and the protein functions as a structural protein in the large subunit of the ribosome. The C-terminal domain consists of two loops, an alpha-helix and a three-stranded mixed parallel, anti-parallel beta-sheet packed against the central alpha-helix. The long central alpha-helix is exposed to solvent in the middle and participates in the hydrophobic cores of the two domains at both ends. ; PDB: 3D5B_I 3PYV_H 3F1H_I 3PYR_H 3MRZ_H 1VSP_G 3MS1_H 1VSA_G 3PYT_H 2WH4_I ....
Probab=20.31  E-value=76  Score=21.81  Aligned_cols=17  Identities=35%  Similarity=0.808  Sum_probs=13.5

Q ss_pred             cCCCCCCC-CCCCEEEEE
Q 028968          139 SERPIPDI-RTGDVVEIK  155 (201)
Q Consensus       139 ~kkdiPeF-r~GDtVrV~  155 (201)
                      +.+|+|.+ +.||+|.|.
T Consensus         5 L~~dv~~lG~~Gdiv~V~   22 (48)
T PF01281_consen    5 LLKDVPGLGKKGDIVEVK   22 (48)
T ss_dssp             ESSCCTTSBSTTEEEE-S
T ss_pred             EcccccccCCCCCEEEEc
Confidence            56899986 999999984


No 126
>PRK12786 flgA flagellar basal body P-ring biosynthesis protein FlgA; Reviewed
Probab=20.26  E-value=2.6e+02  Score=25.97  Aligned_cols=47  Identities=9%  Similarity=0.140  Sum_probs=33.4

Q ss_pred             CCCCCCCCEEEEEEEeecCCcccceEEEEEEEeecCCccceEEEEeeeCCee
Q 028968          143 IPDIRTGDVVEIKLEVPENRRRLSIYKGIVMSRQNAGIHTTIRIRRIIAGIG  194 (201)
Q Consensus       143 iPeFr~GDtVrV~v~I~EnKeRiQ~FeGIVIarrn~Gi~sTFTVRKIs~GVG  194 (201)
                      -+-++-||.|.|.+...-    ++ ...-..|..+.+++.+++|||...|-=
T Consensus       256 p~lV~rGd~V~i~~~~gg----l~-v~~~G~ALe~G~~Gd~IrV~N~~S~ki  302 (338)
T PRK12786        256 PDLVQRGQLVTLIYQTPG----IY-LTARGKALEDGAEGDVVRVLNLQSKRT  302 (338)
T ss_pred             ccEEcCCCEEEEEEEcCC----EE-EEEEEEEccccCCCCEEEEEECCCCCE
Confidence            456899999999886432    21 123446777888999999999866643


No 127
>PRK08572 rps17p 30S ribosomal protein S17P; Reviewed
Probab=20.05  E-value=1.2e+02  Score=24.40  Aligned_cols=22  Identities=32%  Similarity=0.600  Sum_probs=17.0

Q ss_pred             ccceEEEEEEEeecCCccceEEEEe
Q 028968          164 RLSIYKGIVMSRQNAGIHTTIRIRR  188 (201)
Q Consensus       164 RiQ~FeGIVIarrn~Gi~sTFTVRK  188 (201)
                      |-|.|+|+|++.+   ++.|.+|+-
T Consensus        28 rgk~l~G~VvS~K---m~KTvvV~v   49 (108)
T PRK08572         28 RGQVLEGTVVSDK---MHKTVVVER   49 (108)
T ss_pred             eeEEEEEEEEecC---CCceEEEEE
Confidence            4578999999975   678888753


No 128
>PF01336 tRNA_anti-codon:  OB-fold nucleic acid binding domain;  InterPro: IPR004365 The OB-fold (oligonucleotide/oligosaccharide-binding fold) is found in all three kingdoms and its common architecture presents a binding face that has adapted to bind different ligands. The OB-fold is a five/six-stranded closed beta-barrel formed by 70-80 amino acid residues. The strands are connected by loops of varying length which form the functional appendages of the protein. The majority of OB-fold proteins use the same face for ligand binding or as an active site. Different OB-fold proteins use this 'fold-related binding face' to, variously, bind oligosaccharides, oligonucleotides, proteins, metal ions and catalytic substrates.  This entry contains OB-fold domains that bind to nucleic acids []. It includes the anti-codon binding domain of lysyl, aspartyl, and asparaginyl-tRNA synthetases (See IPR004364 from INTERPRO). Aminoacyl-tRNA synthetases catalyse the addition of an amino acid to the appropriate tRNA molecule 6.1.1 from EC. This domain is found in RecG helicase involved in DNA repair. Replication factor A is a heterotrimeric complex, that contains a subunit in this family [, ]. This domain is also found at the C terminus of bacterial DNA polymerase III alpha chain.; GO: 0003676 nucleic acid binding; PDB: 1BBU_A 1KRS_A 1BBW_A 1KRT_A 1EQR_B 1IL2_B 1C0A_A 3KFU_A 1EOV_A 1ASY_A ....
Probab=20.01  E-value=1.3e+02  Score=19.91  Aligned_cols=19  Identities=21%  Similarity=0.489  Sum_probs=13.9

Q ss_pred             CCCCCCEEEEEEEeecCCc
Q 028968          145 DIRTGDVVEIKLEVPENRR  163 (201)
Q Consensus       145 eFr~GDtVrV~v~I~EnKe  163 (201)
                      .+++||.|.|.=++...+.
T Consensus        44 ~l~~g~~v~v~G~v~~~~~   62 (75)
T PF01336_consen   44 KLKEGDIVRVRGKVKRYNG   62 (75)
T ss_dssp             TS-TTSEEEEEEEEEEETT
T ss_pred             cCCCCeEEEEEEEEEEECC
Confidence            3779999999977777433


Done!