BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028978
         (201 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q09MC9|NU5C_CITSI NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic OS=Citrus
           sinensis GN=ndhF PE=3 SV=1
          Length = 743

 Score = 30.8 bits (68), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 3/69 (4%)

Query: 18  KTLFFLITMLVSLLLFSAPVLLAIADTLLPSALLSASLSPSSLSLSTLSSHFNDYDFRYS 77
            T+ F++ +LV   LF   + + +   ++ S +LS  L+PS   L   S+HF D+   Y 
Sbjct: 544 NTILFVMLVLVLFPLFVGAIGIPLNQEVIESDILSKLLTPSINLLQQNSTHFVDW---YE 600

Query: 78  LVDIPLISI 86
           +V  P +S+
Sbjct: 601 VVKNPTLSV 609


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.331    0.142    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 61,504,520
Number of Sequences: 539616
Number of extensions: 2143160
Number of successful extensions: 7428
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 7426
Number of HSP's gapped (non-prelim): 6
length of query: 201
length of database: 191,569,459
effective HSP length: 112
effective length of query: 89
effective length of database: 131,132,467
effective search space: 11670789563
effective search space used: 11670789563
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 58 (26.9 bits)