Query         028984
Match_columns 200
No_of_seqs    110 out of 137
Neff          3.1 
Searched_HMMs 46136
Date          Fri Mar 29 05:38:02 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/028984.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/028984hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02234 CDI:  Cyclin-dependent  99.7 3.4E-19 7.3E-24  122.8   2.2   46  151-196     5-51  (51)
  2 KOG4743 Cyclin-dependent kinas  98.8 5.5E-09 1.2E-13   89.7   5.4   47  152-198    26-74  (195)
  3 TIGR01878 cas_Csa5 CRISPR-asso  55.2      16 0.00035   29.0   3.4   24  147-170    60-83  (97)
  4 PF09702 Cas_Csa5:  CRISPR-asso  49.2      20 0.00043   28.9   3.1   23  147-169    68-90  (105)
  5 PF04244 DPRP:  Deoxyribodipyri  38.4      11 0.00024   32.7   0.2   18  174-191   171-188 (224)
  6 PF12983 DUF3867:  Protein of u  34.1      25 0.00053   30.8   1.6   15  167-181    62-76  (186)
  7 cd08002 WGR_PARP3_like WGR dom  22.6 1.4E+02  0.0031   22.9   3.9   14  183-196    86-99  (100)
  8 COG3200 AroG 3-deoxy-D-arabino  20.7      93   0.002   30.4   2.9   42  150-191   147-200 (445)
  9 cd07997 WGR_PARP WGR domain of  19.3   2E+02  0.0044   21.6   4.1   34  163-196    65-101 (102)
 10 PF14420 Clr5:  Clr5 domain      18.8      50  0.0011   22.6   0.6   18  161-179    36-53  (54)

No 1  
>PF02234 CDI:  Cyclin-dependent kinase inhibitor;  InterPro: IPR003175 Cell cycle progression is negatively controlled by cyclin-dependent kinases inhibitors (CDIs). CDIs are involved in cell cycle arrest at the G1 phase.; GO: 0004861 cyclin-dependent protein kinase inhibitor activity, 0007050 cell cycle arrest, 0005634 nucleus; PDB: 1H27_E 1JSU_C.
Probab=99.75  E-value=3.4e-19  Score=122.77  Aligned_cols=46  Identities=43%  Similarity=0.928  Sum_probs=39.0

Q ss_pred             CCC-hHHHHHHHHHHHHHHHHHHHhhhCCcccCCccCCCccceEEcC
Q 028984          151 IPS-AAEIDEFFTAAEKREQERFAEKYNYDIVNDLPLEGRYQWVRLN  196 (200)
Q Consensus       151 ~Pt-~~E~eeFFa~aEke~q~rF~~KyNFDf~~d~PLeGRYEW~~v~  196 (200)
                      .|+ .+||+.||++++++++++|++||||||++|+||+|||+|++|+
T Consensus         5 gp~d~~e~~~~~~~~l~~~~e~~~~kWNFDF~~~~PL~GryeWe~v~   51 (51)
T PF02234_consen    5 GPVDHEELERFFQEELQEQREEFSEKWNFDFVNDTPLPGRYEWERVD   51 (51)
T ss_dssp             ----HHHHHHHHHHHHTTTTHHHHHHHTEETTTTEE-SSSS--EEEE
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCccCCCCeEeEeCC
Confidence            366 8999999999999999999999999999999999999999985


No 2  
>KOG4743 consensus Cyclin-dependent kinase inhibitor [Signal transduction mechanisms]
Probab=98.81  E-value=5.5e-09  Score=89.73  Aligned_cols=47  Identities=26%  Similarity=0.516  Sum_probs=41.7

Q ss_pred             CChHHHHHHHHHHHHHHHHHHHhhhCCcccCCccCCC--ccceEEcCCC
Q 028984          152 PSAAEIDEFFTAAEKREQERFAEKYNYDIVNDLPLEG--RYQWVRLNEA  198 (200)
Q Consensus       152 Pt~~E~eeFFa~aEke~q~rF~~KyNFDf~~d~PLeG--RYEW~~v~~~  198 (200)
                      |..+|+---|.+.=+++++..++||||||..++||+|  +|+|+.|+-+
T Consensus        26 vd~EElSR~l~s~l~~m~~e~~~KWnFDFq~~~PL~g~g~y~we~V~~~   74 (195)
T KOG4743|consen   26 VDHEELSRDLNSRLERMNEEDQQKWNFDFQQGTPLEGSGDYEWEEVSSD   74 (195)
T ss_pred             CCHHHHhHHHHHHHHHHHHHHHhccCcccccCCcccCCCCceeEEccCC
Confidence            6777787778888789999999999999999999997  9999999754


No 3  
>TIGR01878 cas_Csa5 CRISPR-associated protein, Csa5 family. CRISPR is a term for Clustered, Regularly Interspaced Short Palidromic Repeats. A number of protein families appear only in association with these repeats and are designated Cas (CRISPR-Associated) proteins. This model represents a minor family of Cas protein found in the (all archaeal) APERN subtype of CRISPR/Cas locus, so the family is designated Csa5, for CRISPR/Cas Subtype Protein 5.
Probab=55.20  E-value=16  Score=29.00  Aligned_cols=24  Identities=13%  Similarity=0.303  Sum_probs=20.6

Q ss_pred             ccCCCCChHHHHHHHHHHHHHHHH
Q 028984          147 EEEKIPSAAEIDEFFTAAEKREQE  170 (200)
Q Consensus       147 ~~~~~Pt~~E~eeFFa~aEke~q~  170 (200)
                      ..+.+|+++|++.||..+++++..
T Consensus        60 ~~~~lptdeeVe~f~r~~~~di~~   83 (97)
T TIGR01878        60 LVGYLPTDKEVEDFLRDVREDIRY   83 (97)
T ss_pred             ecCCCCcHHHHHHHHHHhHHHHHH
Confidence            355899999999999999988764


No 4  
>PF09702 Cas_Csa5:  CRISPR-associated protein (Cas_Csa5);  InterPro: IPR010157 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.  This entry represents a minor family of Cas protein found in various species of Sulfolobus and Pyrococcus (all archaeal). It is found with two different CRISPR loci in Sulfolobus solfataricus.
Probab=49.17  E-value=20  Score=28.91  Aligned_cols=23  Identities=17%  Similarity=0.387  Sum_probs=20.4

Q ss_pred             ccCCCCChHHHHHHHHHHHHHHH
Q 028984          147 EEEKIPSAAEIDEFFTAAEKREQ  169 (200)
Q Consensus       147 ~~~~~Pt~~E~eeFFa~aEke~q  169 (200)
                      ..+.+|+.+|++.|....|+++.
T Consensus        68 ~~g~lPt~~eVe~Fl~~v~~di~   90 (105)
T PF09702_consen   68 IVGYLPTDEEVEDFLDDVERDIY   90 (105)
T ss_pred             ecCCCCChHHHHHHHHHHHHHHH
Confidence            46789999999999999999864


No 5  
>PF04244 DPRP:  Deoxyribodipyrimidine photo-lyase-related protein;  InterPro: IPR007357 This family appears to be related to DNA photolyases.; PDB: 3ZXS_A.
Probab=38.36  E-value=11  Score=32.73  Aligned_cols=18  Identities=28%  Similarity=0.348  Sum_probs=7.2

Q ss_pred             hhhCCcccCCccCCCccc
Q 028984          174 EKYNYDIVNDLPLEGRYQ  191 (200)
Q Consensus       174 ~KyNFDf~~d~PLeGRYE  191 (200)
                      -|||||-.|-.|+|+...
T Consensus       171 GkWnfD~eNRk~~p~~~~  188 (224)
T PF04244_consen  171 GKWNFDAENRKKLPKGIP  188 (224)
T ss_dssp             GSS--GGGS-------TT
T ss_pred             CcCCCChhhccCCCCCCC
Confidence            399999999999997653


No 6  
>PF12983 DUF3867:  Protein of unknown function (DUF3867);  InterPro: IPR024218 This entry represents a family of functionally uncharacterised proteins that are found in bacteria. Proteins in this family are approximately 190 amino acids in length.
Probab=34.06  E-value=25  Score=30.84  Aligned_cols=15  Identities=33%  Similarity=0.694  Sum_probs=13.6

Q ss_pred             HHHHHHHhhhCCccc
Q 028984          167 REQERFAEKYNYDIV  181 (200)
Q Consensus       167 e~q~rF~~KyNFDf~  181 (200)
                      .||+.|.+||.||+.
T Consensus        62 niQkk~mERYGfd~~   76 (186)
T PF12983_consen   62 NIQKKFMERYGFDPS   76 (186)
T ss_pred             HHHHHHHHHhCCCHH
Confidence            799999999999964


No 7  
>cd08002 WGR_PARP3_like WGR domain of poly(ADP-ribose) polymerase 3 and similar proteins. The WGR domain is found in a variety of eukaryotic poly(ADP-ribose) polymerases (PARPs). It has been called WGR after the most conserved central motif of the domain. The domain typically occurs together with a catalytic PARP domain, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain. PARPs catalyze the NAD(+)-dependent synthesis of ADP-ribose polymers and their addition to various nuclear proteins. Higher eukaryotes contain several PARPs and and there may be up to 17 human PARP-like proteins, with three of them (PARP-1, PARP-2, and PARP-3) containing a WGR domain. The synthesis of poly-ADP-ribose requires multiple enzymatic activities for initiation, trans-ADP-ribosylation, elongation, branching, and release of the polymer from the enzyme. This subfamily is composed of human PARP-3 and similar proteins, including Arabidopsis thaliana PARP-
Probab=22.64  E-value=1.4e+02  Score=22.89  Aligned_cols=14  Identities=21%  Similarity=0.653  Sum_probs=11.8

Q ss_pred             CccCCCccceEEcC
Q 028984          183 DLPLEGRYQWVRLN  196 (200)
Q Consensus       183 d~PLeGRYEW~~v~  196 (200)
                      ..|.||+|-|..++
T Consensus        86 f~k~~gky~~ie~d   99 (100)
T cd08002          86 FVPHPGKYTLIEMD   99 (100)
T ss_pred             CCcCCCcceEEEec
Confidence            45889999999876


No 8  
>COG3200 AroG 3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase [Amino acid transport and metabolism]
Probab=20.71  E-value=93  Score=30.37  Aligned_cols=42  Identities=24%  Similarity=0.454  Sum_probs=32.7

Q ss_pred             CCCChHHHHHHH--HHHHHHHHHHHH----------hhhCCcccCCccCCCccc
Q 028984          150 KIPSAAEIDEFF--TAAEKREQERFA----------EKYNYDIVNDLPLEGRYQ  191 (200)
Q Consensus       150 ~~Pt~~E~eeFF--a~aEke~q~rF~----------~KyNFDf~~d~PLeGRYE  191 (200)
                      .+|.++-|..=|  ++|-..+-+.|.          .+||-+|+++-|+--||+
T Consensus       147 R~pdP~R~l~aY~qsaAtlNLlRafa~gG~A~L~~vh~W~l~Fv~~sp~~~rY~  200 (445)
T COG3200         147 REPDPERLLKAYAQSAATLNLLRAFASGGLADLENVHRWNLGFVKNSPQGARYE  200 (445)
T ss_pred             cCCCHHHHHHHHHHHHHHHHHHHHHhccccchHHHHHHHHHhhhcCCchHHHHH
Confidence            467777666666  445557778887          589999999999999996


No 9  
>cd07997 WGR_PARP WGR domain of poly(ADP-ribose) polymerases. The WGR domain is found in a variety of eukaryotic poly(ADP-ribose) polymerases (PARPs). It has been called WGR after the most conserved central motif of the domain. The domain typically occurs together with a catalytic PARP domain, and is between 70 and 80 residues in length. It has been proposed to function as a nucleic acid binding domain. PARPs catalyze the NAD(+)-dependent synthesis of ADP-ribose polymers and their addition to various nuclear proteins and histones. Higher eukaryotes contain several PARPs and there may be up to 17 human PARP-like proteins, with three of them (PARP-1, PARP-2, and PARP-3) containing a WGR domain. The synthesis of poly-ADP-ribose requires multiple enzymatic activities for initiation, trans-ADP-ribosylation, elongation, branching, and release of the polymer from the enzyme. Poly-ADP-ribosylation was thought to be a reversible post-translational covalent modification that serves as a regulator
Probab=19.33  E-value=2e+02  Score=21.64  Aligned_cols=34  Identities=24%  Similarity=0.277  Sum_probs=21.6

Q ss_pred             HHHHHHHHHHHhhhCCc---ccCCccCCCccceEEcC
Q 028984          163 AAEKREQERFAEKYNYD---IVNDLPLEGRYQWVRLN  196 (200)
Q Consensus       163 ~aEke~q~rF~~KyNFD---f~~d~PLeGRYEW~~v~  196 (200)
                      .|.++-++.|.+|=.-+   -.+..+.+|.|.|+.++
T Consensus        65 ~A~~~F~k~f~~Kt~~~w~~r~~f~k~~~ky~~i~~d  101 (102)
T cd07997          65 SAIKEFEKKFKDKTGNEWENRPLFKKQPGKYALVELD  101 (102)
T ss_pred             HHHHHHHHHHHHHHCCccccccccccCCCceeEEeec
Confidence            34444445555554333   35677888999999876


No 10 
>PF14420 Clr5:  Clr5 domain
Probab=18.81  E-value=50  Score=22.61  Aligned_cols=18  Identities=28%  Similarity=0.713  Sum_probs=11.9

Q ss_pred             HHHHHHHHHHHHHhhhCCc
Q 028984          161 FTAAEKREQERFAEKYNYD  179 (200)
Q Consensus       161 Fa~aEke~q~rF~~KyNFD  179 (200)
                      |.+.+++...+|. +|+|.
T Consensus        36 F~at~rqy~~r~~-~Wg~~   53 (54)
T PF14420_consen   36 FKATKRQYKRRFK-KWGFR   53 (54)
T ss_pred             CCcCHHHHHHHHH-HcCCC
Confidence            4445777777776 77774


Done!