BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 028989
(200 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3NAZ|A Chain A, Basal State Form Of Yeast Glycogen Synthase
pdb|3NAZ|B Chain B, Basal State Form Of Yeast Glycogen Synthase
pdb|3NAZ|C Chain C, Basal State Form Of Yeast Glycogen Synthase
pdb|3NAZ|D Chain D, Basal State Form Of Yeast Glycogen Synthase
pdb|3NCH|A Chain A, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
pdb|3NCH|B Chain B, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
pdb|3NCH|C Chain C, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
pdb|3NCH|D Chain D, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
pdb|3O3C|A Chain A, Glycogen Synthase Basal State Udp Complex
pdb|3O3C|B Chain B, Glycogen Synthase Basal State Udp Complex
pdb|3O3C|C Chain C, Glycogen Synthase Basal State Udp Complex
pdb|3O3C|D Chain D, Glycogen Synthase Basal State Udp Complex
pdb|3RSZ|A Chain A, Maltodextran Bound Basal State Conformation Of Yeast
Glycogen Synthase Isoform 2
pdb|3RSZ|B Chain B, Maltodextran Bound Basal State Conformation Of Yeast
Glycogen Synthase Isoform 2
pdb|3RSZ|C Chain C, Maltodextran Bound Basal State Conformation Of Yeast
Glycogen Synthase Isoform 2
pdb|3RSZ|D Chain D, Maltodextran Bound Basal State Conformation Of Yeast
Glycogen Synthase Isoform 2
Length = 725
Score = 31.6 bits (70), Expect = 0.27, Method: Compositional matrix adjust.
Identities = 15/38 (39%), Positives = 22/38 (57%)
Query: 103 RKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVS 140
R+ LRRG P+ L+ +EL D N+ +L GG V+
Sbjct: 630 RQLALRRGYPDQFRELVGEELNDSNMDALAGGKKLKVA 667
>pdb|3NB0|A Chain A, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
Synthase
pdb|3NB0|B Chain B, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
Synthase
pdb|3NB0|C Chain C, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
Synthase
pdb|3NB0|D Chain D, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
Synthase
pdb|3RT1|A Chain A, Maltodextarn Bound Activated State Form Of Yeast Glycogen
Synthase Isoform 2
pdb|3RT1|B Chain B, Maltodextarn Bound Activated State Form Of Yeast Glycogen
Synthase Isoform 2
pdb|3RT1|C Chain C, Maltodextarn Bound Activated State Form Of Yeast Glycogen
Synthase Isoform 2
pdb|3RT1|D Chain D, Maltodextarn Bound Activated State Form Of Yeast Glycogen
Synthase Isoform 2
Length = 725
Score = 31.6 bits (70), Expect = 0.28, Method: Compositional matrix adjust.
Identities = 15/38 (39%), Positives = 22/38 (57%)
Query: 103 RKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVS 140
R+ LRRG P+ L+ +EL D N+ +L GG V+
Sbjct: 630 RQLALRRGYPDQFRELVGEELNDSNMDALAGGKKLKVA 667
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.137 0.423
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,538,544
Number of Sequences: 62578
Number of extensions: 197291
Number of successful extensions: 268
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 266
Number of HSP's gapped (non-prelim): 3
length of query: 200
length of database: 14,973,337
effective HSP length: 94
effective length of query: 106
effective length of database: 9,091,005
effective search space: 963646530
effective search space used: 963646530
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 49 (23.5 bits)