BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 028989
         (200 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3NAZ|A Chain A, Basal State Form Of Yeast Glycogen Synthase
 pdb|3NAZ|B Chain B, Basal State Form Of Yeast Glycogen Synthase
 pdb|3NAZ|C Chain C, Basal State Form Of Yeast Glycogen Synthase
 pdb|3NAZ|D Chain D, Basal State Form Of Yeast Glycogen Synthase
 pdb|3NCH|A Chain A, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
 pdb|3NCH|B Chain B, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
 pdb|3NCH|C Chain C, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
 pdb|3NCH|D Chain D, Yeast Glycogen Synthase (Gsy2p) Basal State Conformation
 pdb|3O3C|A Chain A, Glycogen Synthase Basal State Udp Complex
 pdb|3O3C|B Chain B, Glycogen Synthase Basal State Udp Complex
 pdb|3O3C|C Chain C, Glycogen Synthase Basal State Udp Complex
 pdb|3O3C|D Chain D, Glycogen Synthase Basal State Udp Complex
 pdb|3RSZ|A Chain A, Maltodextran Bound Basal State Conformation Of Yeast
           Glycogen Synthase Isoform 2
 pdb|3RSZ|B Chain B, Maltodextran Bound Basal State Conformation Of Yeast
           Glycogen Synthase Isoform 2
 pdb|3RSZ|C Chain C, Maltodextran Bound Basal State Conformation Of Yeast
           Glycogen Synthase Isoform 2
 pdb|3RSZ|D Chain D, Maltodextran Bound Basal State Conformation Of Yeast
           Glycogen Synthase Isoform 2
          Length = 725

 Score = 31.6 bits (70), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 103 RKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVS 140
           R+  LRRG P+    L+ +EL D N+ +L GG    V+
Sbjct: 630 RQLALRRGYPDQFRELVGEELNDSNMDALAGGKKLKVA 667


>pdb|3NB0|A Chain A, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
           Synthase
 pdb|3NB0|B Chain B, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
           Synthase
 pdb|3NB0|C Chain C, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
           Synthase
 pdb|3NB0|D Chain D, Glucose-6-Phosphate Activated Form Of Yeast Glycogen
           Synthase
 pdb|3RT1|A Chain A, Maltodextarn Bound Activated State Form Of Yeast Glycogen
           Synthase Isoform 2
 pdb|3RT1|B Chain B, Maltodextarn Bound Activated State Form Of Yeast Glycogen
           Synthase Isoform 2
 pdb|3RT1|C Chain C, Maltodextarn Bound Activated State Form Of Yeast Glycogen
           Synthase Isoform 2
 pdb|3RT1|D Chain D, Maltodextarn Bound Activated State Form Of Yeast Glycogen
           Synthase Isoform 2
          Length = 725

 Score = 31.6 bits (70), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 15/38 (39%), Positives = 22/38 (57%)

Query: 103 RKRRLRRGGPNSTFSLLRKELRDGNLQSLLGGSSCFVS 140
           R+  LRRG P+    L+ +EL D N+ +L GG    V+
Sbjct: 630 RQLALRRGYPDQFRELVGEELNDSNMDALAGGKKLKVA 667


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.323    0.137    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,538,544
Number of Sequences: 62578
Number of extensions: 197291
Number of successful extensions: 268
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 266
Number of HSP's gapped (non-prelim): 3
length of query: 200
length of database: 14,973,337
effective HSP length: 94
effective length of query: 106
effective length of database: 9,091,005
effective search space: 963646530
effective search space used: 963646530
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 49 (23.5 bits)