BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029005
         (200 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum
           GN=abcC15 PE=3 SV=1
          Length = 1436

 Score = 33.5 bits (75), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 31/61 (50%)

Query: 23  ICTILAIAVIIAGIVVFTGYLVMHPRIPVMSVVGAHLDLFQYDEAGLLETQVTIVIRMRN 82
           I ++L   + + GI  F G+LVM   IP+ S +G  +        G  +T++++   + N
Sbjct: 257 ILSLLGFLIYVIGIAGFVGFLVMLITIPLSSFLGTQISKNLSTSMGYADTRISLTGELIN 316

Query: 83  G 83
           G
Sbjct: 317 G 317


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.326    0.141    0.436 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 74,675,692
Number of Sequences: 539616
Number of extensions: 2917290
Number of successful extensions: 8233
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8232
Number of HSP's gapped (non-prelim): 1
length of query: 200
length of database: 191,569,459
effective HSP length: 112
effective length of query: 88
effective length of database: 131,132,467
effective search space: 11539657096
effective search space used: 11539657096
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 58 (26.9 bits)