BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 029005
(200 letters)
Database: swissprot
539,616 sequences; 191,569,459 total letters
Searching..................................................done
>sp|Q54VC1|ABCCF_DICDI ABC transporter C family member 15 OS=Dictyostelium discoideum
GN=abcC15 PE=3 SV=1
Length = 1436
Score = 33.5 bits (75), Expect = 1.0, Method: Compositional matrix adjust.
Identities = 17/61 (27%), Positives = 31/61 (50%)
Query: 23 ICTILAIAVIIAGIVVFTGYLVMHPRIPVMSVVGAHLDLFQYDEAGLLETQVTIVIRMRN 82
I ++L + + GI F G+LVM IP+ S +G + G +T++++ + N
Sbjct: 257 ILSLLGFLIYVIGIAGFVGFLVMLITIPLSSFLGTQISKNLSTSMGYADTRISLTGELIN 316
Query: 83 G 83
G
Sbjct: 317 G 317
Database: swissprot
Posted date: Mar 23, 2013 2:32 AM
Number of letters in database: 191,569,459
Number of sequences in database: 539,616
Lambda K H
0.326 0.141 0.436
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 74,675,692
Number of Sequences: 539616
Number of extensions: 2917290
Number of successful extensions: 8233
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 8232
Number of HSP's gapped (non-prelim): 1
length of query: 200
length of database: 191,569,459
effective HSP length: 112
effective length of query: 88
effective length of database: 131,132,467
effective search space: 11539657096
effective search space used: 11539657096
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 58 (26.9 bits)