Query         029016
Match_columns 200
No_of_seqs    130 out of 954
Neff          6.7 
Searched_HMMs 46136
Date          Fri Mar 29 06:08:15 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/029016.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/029016hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist 100.0 3.1E-43 6.7E-48  272.2   8.3  120   13-132     1-129 (129)
  2 PF07491 PPI_Ypi1:  Protein pho  49.6      14 0.00031   24.9   2.0   23  159-181    34-56  (60)
  3 PHA00692 hypothetical protein   36.9      13 0.00028   25.1   0.3   10   11-20     35-44  (74)
  4 smart00265 BH4 BH4 Bcl-2 homol  34.6      54  0.0012   18.6   2.5   20   22-41      4-23  (27)
  5 cd05790 S1_Rrp40 S1_Rrp40: Rrp  27.6      74  0.0016   22.8   2.9   30  153-185    47-76  (86)
  6 PF07960 CBP4:  CBP4;  InterPro  25.4      38 0.00082   26.4   1.1   11   20-30     30-40  (128)
  7 PLN02417 dihydrodipicolinate s  23.1      54  0.0012   28.2   1.8   20   11-31    101-120 (280)
  8 smart00707 RPEL Repeat in Dros  23.1      58  0.0013   18.3   1.3   13   16-28      6-18  (26)
  9 PF02180 BH4:  Bcl-2 homology r  21.1 1.2E+02  0.0027   17.1   2.4   20   22-41      4-23  (27)
 10 cd00952 CHBPH_aldolase Trans-o  20.7      62  0.0014   28.3   1.8   20   10-30    107-126 (309)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=100.00  E-value=3.1e-43  Score=272.24  Aligned_cols=120  Identities=46%  Similarity=0.903  Sum_probs=96.5

Q ss_pred             CCCCeEEcCCHHHHHHHHHHHHHhCCCCCC-CceecCCCCCCCCCCcccccccCCceEEEEeec--------ccceeccc
Q 029016           13 LPPGFRFCPTDEELLVHFLQRKVALLPCHP-DVIPDLDLYPYDPWQLNGKALAEGNQWYFYSRK--------TQNRMTGN   83 (200)
Q Consensus        13 LPpG~rF~PTDeELv~~YL~~k~~g~pl~~-~~I~~~Dvy~~~P~~L~~~~~~~~~~wyFF~~~--------r~~R~~g~   83 (200)
                      |||||||+|||+|||.+||++|+.|.+++. ++|+++|||++|||+|+.....++++||||+++        |.+|++++
T Consensus         1 LP~G~rF~PtD~ELi~~yL~~k~~g~~~~~~~~i~~~Diy~~~P~~L~~~~~~~~~~~yFF~~~~~~~~~~~r~~R~~~~   80 (129)
T PF02365_consen    1 LPPGFRFRPTDEELINHYLRPKILGEPLPCEDVIHDVDIYSAHPWELPAKFKGGDEEWYFFSPRKKKYPNGGRPNRVTGG   80 (129)
T ss_dssp             --TTEEE---HHHHHHCTHHHHHTT-HHCS-CHSEE--GGGS-GGGCHHHSSS-SSEEEEEEE----------S-EEETT
T ss_pred             CCCceEecCChHHHHHHHHHHHhcCCCCCcccceeecccCccChHHhhhhccCCCceEEEEEecccccCCcccccccccc
Confidence            899999999999999999999999999887 799999999999999995434466799999997        46788999


Q ss_pred             ceeeeCCcceeEEcCCceeEEEEEEEEeeeCCCCCCCccCeEEEEEEeC
Q 029016           84 GYWKPMGIEESVLTRADKKVGLKKYYIFHLGEASAGVKTNWIMQEYRLS  132 (200)
Q Consensus        84 G~Wk~~g~~k~I~~~~g~~vG~kr~f~F~~~~~~~~~kT~W~M~EY~l~  132 (200)
                      |+||.+|+.+.|.+.+|.+||+|++|+||.++.+++.+|+|+||||+|.
T Consensus        81 G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W~M~EY~L~  129 (129)
T PF02365_consen   81 GYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGWVMHEYSLE  129 (129)
T ss_dssp             EEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEEEEEEEEE-
T ss_pred             eEEeecccccccccccceeeeeEEEEEEEeccCCCCCcCCeEEEEEEeC
Confidence            9999999999998878999999999999998888889999999999983


No 2  
>PF07491 PPI_Ypi1:  Protein phosphatase inhibitor  ;  InterPro: IPR011107 These proteins include Ypi1, a novel Saccharomyces cerevisiae type 1 protein phosphatase inhibitor [] and ppp1r11/hcgv (O60927 from SWISSPROT), annotated as having protein phosphatase inhibitor activity [].
Probab=49.58  E-value=14  Score=24.92  Aligned_cols=23  Identities=22%  Similarity=0.335  Sum_probs=16.2

Q ss_pred             CceEEEEEEEeCCCCCCCCCCcc
Q 029016          159 SKWVICRVFERNCDDDDDGAELS  181 (200)
Q Consensus       159 ~~~VLCkIy~k~~~~~~~~~~~s  181 (200)
                      ..-=+|-||.|++.-.+++++++
T Consensus        34 kkSK~CCIyhk~~~~~esSs~s~   56 (60)
T PF07491_consen   34 KKSKCCCIYHKPRAFDESSSESS   56 (60)
T ss_pred             ccCceeeeecCCCCCCCCccccc
Confidence            34458999999998666555443


No 3  
>PHA00692 hypothetical protein
Probab=36.86  E-value=13  Score=25.07  Aligned_cols=10  Identities=70%  Similarity=1.424  Sum_probs=8.5

Q ss_pred             CCCCCCeEEc
Q 029016           11 VNLPPGFRFC   20 (200)
Q Consensus        11 ~~LPpG~rF~   20 (200)
                      ...||||||-
T Consensus        35 veyppgfrfg   44 (74)
T PHA00692         35 VEYPPGFRFG   44 (74)
T ss_pred             EecCCCcccc
Confidence            4789999995


No 4  
>smart00265 BH4 BH4 Bcl-2 homology region 4.
Probab=34.64  E-value=54  Score=18.59  Aligned_cols=20  Identities=20%  Similarity=0.346  Sum_probs=15.7

Q ss_pred             CHHHHHHHHHHHHHhCCCCC
Q 029016           22 TDEELLVHFLQRKVALLPCH   41 (200)
Q Consensus        22 TDeELv~~YL~~k~~g~pl~   41 (200)
                      +-.|||.+|+.-|+.-...+
T Consensus         4 ~nRelV~~yv~yKLsQrgy~   23 (27)
T smart00265        4 DNRELVVDYVTYKLSQNGYE   23 (27)
T ss_pred             chHHHHHHHHHHHHhhcCCC
Confidence            45799999999999765444


No 5  
>cd05790 S1_Rrp40 S1_Rrp40: Rrp40 S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. Rrp4 protein is a subunit of the exosome complex. The exosome plays a central role in 3' to 5' RNA processing and degradation in eukarytes and archaea. Its functions include the removal of incorrectly processed RNA and the maintenance of proper levels of mRNA, rRNA and a number of small RNA species. In Saccharomyces cerevisiae, the exosome includes nine core components, six of which are homologous to bacterial RNase PH. These form a hexameric ring structure. The other three subunits (RrP4, Rrp40, and Csl4) contain an S1 RNA binding domain and are part of the "S1 pore structure".
Probab=27.56  E-value=74  Score=22.84  Aligned_cols=30  Identities=33%  Similarity=0.491  Sum_probs=22.1

Q ss_pred             CCCCCCCceEEEEEEEeCCCCCCCCCCccchhh
Q 029016          153 NSKTDYSKWVICRVFERNCDDDDDGAELSCMDE  185 (200)
Q Consensus       153 ~~~~~~~~~VLCkIy~k~~~~~~~~~~~s~~~~  185 (200)
                      .+..+.+++|+|||..-.++.   ..+++|.+.
T Consensus        47 rp~L~~GDlV~ArV~~~~~~~---~~eLtc~~~   76 (86)
T cd05790          47 RPNLNVGDLVYARVVKANRDM---EPELSCVDS   76 (86)
T ss_pred             cccCCCCCEEEEEEEecCCCC---CeEEEEeCC
Confidence            345667999999997765542   368899884


No 6  
>PF07960 CBP4:  CBP4;  InterPro: IPR012420 The CBP4 gene in Saccharomyces cerevisiae is essential for the expression and activity of ubiquinol-cytochrome c reductase [, ]. This family appears to be fungal specific. 
Probab=25.43  E-value=38  Score=26.36  Aligned_cols=11  Identities=45%  Similarity=0.893  Sum_probs=9.6

Q ss_pred             cCCHHHHHHHH
Q 029016           20 CPTDEELLVHF   30 (200)
Q Consensus        20 ~PTDeELv~~Y   30 (200)
                      .||||||+..|
T Consensus        30 tPTeEeL~~r~   40 (128)
T PF07960_consen   30 TPTEEELFKRY   40 (128)
T ss_pred             CCCHHHHHHhc
Confidence            49999999876


No 7  
>PLN02417 dihydrodipicolinate synthase
Probab=23.11  E-value=54  Score=28.25  Aligned_cols=20  Identities=25%  Similarity=0.474  Sum_probs=15.5

Q ss_pred             CCCCCCeEEcCCHHHHHHHHH
Q 029016           11 VNLPPGFRFCPTDEELLVHFL   31 (200)
Q Consensus        11 ~~LPpG~rF~PTDeELv~~YL   31 (200)
                      +-+|| +.|.||+++|+.||-
T Consensus       101 ~~~~P-~y~~~~~~~i~~~f~  120 (280)
T PLN02417        101 LHINP-YYGKTSQEGLIKHFE  120 (280)
T ss_pred             EEcCC-ccCCCCHHHHHHHHH
Confidence            34566 568999999999874


No 8  
>smart00707 RPEL Repeat in Drosophila CG10860, human KIAA0680 and C. elegans F26H9.2.
Probab=23.08  E-value=58  Score=18.26  Aligned_cols=13  Identities=38%  Similarity=0.314  Sum_probs=10.8

Q ss_pred             CeEEcCCHHHHHH
Q 029016           16 GFRFCPTDEELLV   28 (200)
Q Consensus        16 G~rF~PTDeELv~   28 (200)
                      ...++|+-+|||.
T Consensus         6 kl~~RP~~eeLv~   18 (26)
T smart00707        6 KLSQRPTREELEE   18 (26)
T ss_pred             HHHcCCCHHHHHH
Confidence            3568999999997


No 9  
>PF02180 BH4:  Bcl-2 homology region 4;  InterPro: IPR003093 Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans []. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death. Bcl-2 proteins are central regulators of caspase activation, and play a key role in cell death by regulating the integrity of the mitochondrial and endoplasmic reticulum (ER) membranes []. At least 20 Bcl-2 proteins have been reported in mammals, and several others have been identified in viruses. Bcl-2 family proteins fall roughly into three subtypes, which either promote cell survival (anti-apoptotic) or trigger cell death (pro-apoptotic). All members contain at least one of four conserved motifs, termed Bcl-2 Homology (BH) domains. Bcl-2 subfamily proteins, which contain at least BH1 and BH2, promote cell survival by inhibiting the adapters needed for the activation of caspases. Pro-apoptotic members potentially exert their effects by displacing the adapters from the pro-survival proteins; these proteins belong either to the Bax subfamily, which contain BH1-BH3, or to the BH3 subfamily, which mostly only feature BH3 []. Thus, the balance between antagonistic family members is believed to play a role in determining cell fate. Members of the wider Bcl-2 family, which also includes Bcl-x, Bcl-w and Mcl-1, are described by their similarity to Bcl-2 protein, a member of the pro-survival Bcl-2 subfamily []. Full-length Bcl-2 proteins feature all four BH domains, seven alpha-helices, and a C-terminal hydrophobic motif that targets the protein to the outer mitochondrial membrane, ER and nuclear envelope.  Active cell suicide (apoptosis) is induced by events such as growth factor withdrawal and toxins. It is controlled by regulators, which have either an inhibitory effect on programmed cell death (anti-apoptotic) or block the protective effect of inhibitors (pro-apoptotic) [, ]. Many viruses have found a way of countering defensive apoptosis by encoding their own anti-apoptosis genes preventing their target-cells from dying too soon.  All proteins belonging to the Bcl-2 family [] contain either a BH1, BH2, BH3, or BH4 domain. All anti-apoptotic proteins contain BH1 and BH2 domains, some of them contain an additional N-terminal BH4 domain (Bcl-2, Bcl-x(L), Bcl-w), which is never seen in pro-apoptotic proteins, except for Bcl-x(S). On the other hand, all pro-apoptotic proteins contain a BH3 domain (except for Bad) necessary for dimerisation with other proteins of Bcl-2 family and crucial for their killing activity, some of them also contain BH1 and BH2 domains (Bax, Bak). The BH3 domain is also present in some anti-apoptotic protein, such as Bcl-2 or Bcl-x(L). Proteins that are known to contain these domains include vertebrate Bcl-2 (alpha and beta isoforms) and Bcl-x (isoforms (Bcl-x(L) and Bcl-x(S)); mammalian proteins Bax and Bak; mouse protein Bid; Xenopus laevis proteins Xr1 and Xr11; human induced myeloid leukemia cell differentiation protein MCL1 and Caenorhabditis elegans protein ced-9.; GO: 0042981 regulation of apoptosis; PDB: 1AF3_A 2PON_B 1YSN_A 3PL7_B 3R85_A 2O2N_A 2P1L_C 1R2G_A 2O1Y_A 1BXL_A ....
Probab=21.06  E-value=1.2e+02  Score=17.14  Aligned_cols=20  Identities=15%  Similarity=0.252  Sum_probs=15.2

Q ss_pred             CHHHHHHHHHHHHHhCCCCC
Q 029016           22 TDEELLVHFLQRKVALLPCH   41 (200)
Q Consensus        22 TDeELv~~YL~~k~~g~pl~   41 (200)
                      .-.|||.+|+.-|+.-...+
T Consensus         4 ~nR~lV~~yi~yKLsQrgy~   23 (27)
T PF02180_consen    4 DNRELVEDYISYKLSQRGYV   23 (27)
T ss_dssp             HHHHHHHHHHHHHHHHTTST
T ss_pred             cHHHHHHHHHHHHhhhcCCC
Confidence            34799999999998765544


No 10 
>cd00952 CHBPH_aldolase Trans-o-hydroxybenzylidenepyruvate hydratase-aldolase (HBPHA) and trans-2'-carboxybenzalpyruvate hydratase-aldolase (CBPHA). HBPHA catalyzes HBP to salicyaldehyde and pyruvate. This reaction is part of the degradative pathways for naphthalene and naphthalenesulfonates by bacteria. CBPHA is homologous to HBPHA and catalyzes the cleavage of CBP to 2-carboxylbenzaldehyde and pyruvate during the degradation of phenanthrene. They are member of the DHDPS family of Schiff-base-dependent class I aldolases.
Probab=20.73  E-value=62  Score=28.33  Aligned_cols=20  Identities=5%  Similarity=0.032  Sum_probs=16.0

Q ss_pred             CCCCCCCeEEcCCHHHHHHHH
Q 029016           10 NVNLPPGFRFCPTDEELLVHF   30 (200)
Q Consensus        10 ~~~LPpG~rF~PTDeELv~~Y   30 (200)
                      -+-+|| |.|.||+++|+.||
T Consensus       107 vlv~~P-~y~~~~~~~l~~yf  126 (309)
T cd00952         107 TMLGRP-MWLPLDVDTAVQFY  126 (309)
T ss_pred             EEECCC-cCCCCCHHHHHHHH
Confidence            356677 66899999999977


Done!