Citrus Sinensis ID: 029039


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200
MGFLAATAAASVYPSAYMELRWVRGRGKGKCELNFKPSMIPIYISTNPSDINPQELSQLFISCNHSCNRFPILDSRDRTVEEAVDIDKLCLALSHSFVVVSVFSNLALSDDESSKRLMVPLLGNLAQRVVPVTPSNGQLVGFGRAVSDVGLTASIHDIMVIPSLRQMGIGRMIVQRILRMLTSREIYDIAALCSEEERYL
cccHHHHHHccccccHHHHHHHHccccccccccccccccccEEEEcccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccCEEECcccccEEEEEEEEECccCEEEEEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccc
***LAATAAASVYPSAYMELRWVRGRGKGKCELNFKPSMIPIYISTNPSDINPQELSQLFISCNHSCNRFPILDSRDRTVEEAVDIDKLCLALSHSFVVVSVFSNLALSDDE*S***MVPLLGNLAQRVVPVTPSNGQLVGFGRAVSDVGLTASIHDIMVIPSLRQMGIGRMIVQRILRMLTSREIYDIAALCSEEERYL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFLAATAAASVYPSAYMELRWVRGRGKGKCELNFKPSMIPIYISTNPSDINPQELSQLFISCNHSCNRFPILDSRDRTVEEAVDIDKLCLALSHSFVVVSVFSNLALSDDESSKRLMVPLLGNLAQRVVPVTPSNGQLVGFGRAVSDVGLTASIHDIMVIPSLRQMGIGRMIVQRILRMLTSREIYDIAALCSEEERYL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3S6F, chain A
Confidence level:very confident
Coverage over the Query: 41-66,82-104,135-198
View the alignment between query and template
View the model in PyMOL
Template: 2O28, chain A
Confidence level:confident
Coverage over the Query: 20-71,83-104,135-198
View the alignment between query and template
View the model in PyMOL
Template: 1YLE, chain A
Confidence level:probable
Coverage over the Query: 43-70,83-109,124-180
View the alignment between query and template
View the model in PyMOL