BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029049
         (200 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EAF|A Chain A, Crystal Structure Of Abc Transporter, Substrate Binding
          Protein Aeropyrum Pernix
          Length = 391

 Score = 26.6 bits (57), Expect = 8.7,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 7  YNPRTVEEVFGDFKGRRAGMIKAL---TTEVEEFYHQCDPEK 45
          YNP T EE + +F+ R  G+I  +   T + E+   Q D +K
Sbjct: 59 YNPTTAEEYYREFRDRY-GVIAIIGWGTADTEKLSDQVDTDK 99


>pdb|1HX1|B Chain B, Crystal Structure Of A Bag Domain In Complex With The
           Hsc70 Atpase Domain
 pdb|3FZF|B Chain B, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH ATP
 pdb|3FZH|B Chain B, Crystal Structures Of Hsc70BAG1 IN COMPLEX WITH SMALL
           Molecule Inhibitors
 pdb|3FZK|B Chain B, Crystal Structures Of Hsc70BAG1 IN COMPLEX WITH SMALL
           Molecule Inhibitors
 pdb|3FZL|B Chain B, Crystal Structures Of Hsc70BAG1 IN COMPLEX WITH SMALL
           Molecule Inhibitors
 pdb|3FZM|B Chain B, Crystal Structures Of Hsc70BAG1 IN COMPLEX WITH SMALL
           Molecule Inhibitors
 pdb|3LDQ|B Chain B, Crystal Structure Of Hsc70BAG1 IN COMPLEX WITH SMALL
           MOLECULE Inhibitor
 pdb|3M3Z|B Chain B, Crystal Structure Of Hsc70/bag1 In Complex With Small
           Molecule Inhibitor
          Length = 114

 Score = 26.6 bits (57), Expect = 9.4,   Method: Compositional matrix adjust.
 Identities = 12/36 (33%), Positives = 22/36 (61%), Gaps = 4/36 (11%)

Query: 14  EVFGDFKGRRAGMIKALTTEVEEFYHQCDPEKENLC 49
           E F D + +R G++K    +V+ F  +CD  ++N+C
Sbjct: 79  ENFKDSRLKRKGLVK----KVQAFLAECDTVEQNIC 110


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.320    0.136    0.416 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,463,631
Number of Sequences: 62578
Number of extensions: 146274
Number of successful extensions: 208
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 208
Number of HSP's gapped (non-prelim): 2
length of query: 200
length of database: 14,973,337
effective HSP length: 94
effective length of query: 106
effective length of database: 9,091,005
effective search space: 963646530
effective search space used: 963646530
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)