BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029072
         (199 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3APZ|A Chain A, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl
           Pyrophosphate Synthase
 pdb|3APZ|B Chain B, Apo Form Of Arabidopsis MediumLONG-Chain Length Prenyl
           Pyrophosphate Synthase
          Length = 348

 Score = 28.5 bits (62), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 20/33 (60%)

Query: 131 LRHAVNPSTLIFLIHVFPQVKFVPSPLGKLPRN 163
           +RH V  + ++F +  FPQ++ V   + K PRN
Sbjct: 254 IRHGVITAPILFAMEEFPQLREVVDQVEKDPRN 286


>pdb|3HK0|A Chain A, Crystal Structure Of The Ra And Ph Domains Of Grb10
 pdb|3HK0|B Chain B, Crystal Structure Of The Ra And Ph Domains Of Grb10
          Length = 256

 Score = 28.1 bits (61), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 6/47 (12%)

Query: 147 FPQVKFVPSPLGKLPRNQVNPEQLETFMAQETGKRRQLLQKFLDTCS 193
           + + +F  +P+   P      EQ+ T+  Q  G + QLLQ FL++ S
Sbjct: 90  YAKYEFFKNPMNFFP------EQMVTWSQQSNGSQTQLLQNFLNSSS 130


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.131    0.370 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,425,879
Number of Sequences: 62578
Number of extensions: 151579
Number of successful extensions: 230
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 228
Number of HSP's gapped (non-prelim): 2
length of query: 199
length of database: 14,973,337
effective HSP length: 94
effective length of query: 105
effective length of database: 9,091,005
effective search space: 954555525
effective search space used: 954555525
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 49 (23.5 bits)