Citrus Sinensis ID: 029084

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20

MFSTPKAFVKIYFNCPHASSSPESEVLTDIFTRLLLDYLNEYAYYAQVAGLDYGINHTESGFEVTVVGYNHKLRILLETIFQKIAQFKVKPDRFSVIKEMVTKEYHNNKFLQPFQLAMYYCSLILQDQTWPWMEELEVLPHLEAEDLAKFVPMMLSRTFLECYIETLNLMKQDRLSSTLKMFSLRAQTQYANHCSHPSI

cccccEEEEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHcccEEEEECccccEEEEEEEcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHcccccHHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHcccccccccccccccc

MFSTPKAFVKIYFNCPHASSSPESEVLTDIFTRLLLDYLNEYAYYAQVAGLDYGINHTESGFEVTVVGYNHKLRILLETIFQKIAQFKVKPDRFSVIKEMVTKEYHNNKFLQPFQLAMYYCSLILQDQTWPWMEELEVLPHLEAEDLAKFVPMMLSRTFLECYIETLNLMKQDRLSSTLKMFSL***************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFSTPKAFVKIYFNCPHASSSPESEVLTDIFTRLLLDYLNEYAYYAQVAGLDYGINHTESGFEVTVVGYNHKLRILLETIFQKIAQFKVKPDRFSVIKEMVTKEYHNNKFLQPFQLAMYYCSLILQDQTWPWMEELEVLPHLEAEDLAKFVPMMLSRTFLECYIETLNLMKQDRLSSTLKMFSLRAQTQYANHCSHPSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Zinc-metallopeptidase, peroxisomal	Peptidase that might be involved in pathogen or wound response. Not required for peroxisome biogenesis, indole-3-butyric acid (IBA) metabolism, fatty acid beta-oxidation or degradation of glyoxylate cycle enzymes during seedling development.	probable	O22941

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CWW, chain A
Confidence level:very confident
Coverage over the Query: 1-186
View the alignment between query and template
View the model in PyMOL