BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029099
         (199 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2REE|A Chain A, Crystal Structure Of The Loading Gnatl Domain Of Cura From
           Lyngbya Majuscula
 pdb|2REE|B Chain B, Crystal Structure Of The Loading Gnatl Domain Of Cura From
           Lyngbya Majuscula
 pdb|2REF|A Chain A, Crystal Structure Of The Loading Gnatl Domain Of Cura From
           Lyngbya Majuscula Soaked With Malonyl-Coa
 pdb|2REF|B Chain B, Crystal Structure Of The Loading Gnatl Domain Of Cura From
           Lyngbya Majuscula Soaked With Malonyl-Coa
          Length = 224

 Score = 27.7 bits (60), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 39/92 (42%), Gaps = 13/92 (14%)

Query: 99  LGTERGSVVVKWAVMILYSLLFAIGLSRALPLSCIFLCAMTSPIGKLVVSYVEENHKDKG 158
           L TE G VV   AV IL  L    GL   L    +  CA  S + K+V   +  N+ D  
Sbjct: 91  LHTESGVVVQLLAVNILPELQNQ-GLGDRLLEFMLQYCAQISGVEKVVAVTLCRNYPDYS 149

Query: 159 KIFMAKYY------------CVRFHALFGAAL 178
            + MA+Y              +RFH + GA +
Sbjct: 150 PMPMAEYIHQKNESGLLVDPLLRFHQIHGAKI 181


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.330    0.143    0.441 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,909,433
Number of Sequences: 62578
Number of extensions: 160386
Number of successful extensions: 256
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 256
Number of HSP's gapped (non-prelim): 1
length of query: 199
length of database: 14,973,337
effective HSP length: 94
effective length of query: 105
effective length of database: 9,091,005
effective search space: 954555525
effective search space used: 954555525
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 49 (23.5 bits)