Citrus Sinensis ID: 029107


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MIFETMSTVNIANVTVLDNPAPFLSPFQFEISYECVTPLKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVLQADPPDPSKIREEDIIGVTVLLLTCSYLGQEFVRVGYYVNNDYGDEQLREEPPQKVLIDTVQRNILSDKPRVTKFPINFHPEHAESGEEPPPPPHHPAEVDPHQDDSSSPPDHPLDNQEP
cccccccEEEEEEEEEccccccccccEEEEEEEECccccccccEEEEEEECccccccccEEEEEEEEccCCccCEEEEEECccccccccccccEEEEEEEEEEEEEccEEEEEEEEEEEECcccccccccccccccccEEEEEEcccccCEEEEEEccccccccccccccccccccccccccccccccccccccccccc
*I*ETMSTVNIANVTVLDNPAPFLSPFQFEISYECVTPLKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVLQADPPDPSKIREEDIIGVTVLLLTCSYLGQEFVRVGYYVNNDYGDEQLREEPPQKVLIDTVQRNILSDKPRVTKFPINFHP***************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIFETMSTVNIANVTVLDNPAPFLSPFQFEISYECVTPLKDDLEWKLIYVGSAEDETYDQLLESVLVGPVNVGNYRFVLQADPPDPSKIREEDIIGVTVLLLTCSYLGQEFVRVGYYVNNDYGDEQLREEPPQKVLIDTVQRNILSDKPRVTKFPINFHPEHAESGEEPPPPPHHPAEVDPHQDDSSSPPDHPLDNQEP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone chaperone ASF1B Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly.probableQ9LS09
Histone chaperone asf1 Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Plays a role in the formation of silent heterochromatin.probableQ9V464
Histone chaperone ASF1B Histone chaperone that facilitates histone deposition and histone exchange and removal during nucleosome assembly and disassembly. Cooperates with chromatin assembly factor 1 (CAF-1) to promote replication-dependent chromatin assembly. Does not participate in replication-independent nucleosome deposition which is mediated by ASF1A and HIRA.probableQ9DAP7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HUE, chain A
Confidence level:very confident
Coverage over the Query: 6-170
View the alignment between query and template
View the model in PyMOL