Citrus Sinensis ID: 029110


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MASLSITTSIPPPWLTSKSTHHSRRIPSASLILRTGRSSVSVNVAGNNSSPSRPGLLHCSFVSSSLCSSAFHSAFSGLSLGLDFNSNAGVRKEKRQGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRDQVVEISTFQLRNHLFNGCNIAVINEARNCLLRRIAKQETFMVCDRPFHLFFK
ccccccccccccccccccccccccccccccEEEECcccCEEEEEEccccccccccccEEcccccccccccccccccccEEcEEEECcccCECccccEEEEEccccEEEEEcccccccHHHHHHHHcccccccHHHHHHHHHHHccccEEEcccccHHHccccccccEEEEEHHHHHHHHHHHHccCEEECccccccccc
*******************************************************LLHCSFVSSSLCSSAFHSAFSGLSLGLDFNSNAGV*****QGLVVRAGKAALC************************************GRDQVVEISTFQLRNHLFNGCNIAVINEARNCLLRRIAKQETFMVCDRPFHLFFK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASLSITTSIPPPWLTSKSTHHSRRIPSASLILRTGRSSVSVNVAGNNSSPSRPGLLHCSFVSSSLCSSAFHSAFSGLSLGLDFNSNAGVRKEKRQGLVVRAGKAALCQTKRNRSRKSLARTHGFRRRMRTTSGRAILKRRRAKGRDQVVEISTFQLRNHLFNGCNIAVINEARNCLLRRIAKQETFMVCDRPFHLFFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L34 probableC1CZV9
50S ribosomal protein L34, chloroplastic This protein binds directly to 23S ribosomal RNA.probableQ9LP37

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain 4
Confidence level:very confident
Coverage over the Query: 115-151
View the alignment between query and template
View the model in PyMOL