Query         029117
Match_columns 198
No_of_seqs    163 out of 510
Neff          3.5 
Searched_HMMs 46136
Date          Fri Mar 29 07:45:56 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/029117.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/029117hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd00021 BBOX B-Box-type zinc f  97.6 4.6E-05   1E-09   47.3   2.6   38    2-45      1-39  (39)
  2 smart00336 BBOX B-Box-type zin  97.1 0.00047   1E-08   43.3   2.8   39    1-45      3-42  (42)
  3 PF00643 zf-B_box:  B-box zinc   97.0 0.00055 1.2E-08   43.8   2.3   39    1-45      3-42  (42)
  4 PF10446 DUF2457:  Protein of u  93.7   0.026 5.7E-07   54.2   1.0    7  122-128   121-127 (458)
  5 PF10446 DUF2457:  Protein of u  93.0   0.068 1.5E-06   51.4   2.5    9  119-127    86-94  (458)
  6 PF04931 DNA_pol_phi:  DNA poly  91.0    0.17 3.6E-06   50.5   2.8    7  175-181   772-778 (784)
  7 PF09026 CENP-B_dimeris:  Centr  90.9   0.069 1.5E-06   42.3   0.0    8  117-124    37-44  (101)
  8 KOG4367 Predicted Zn-finger pr  88.7   0.088 1.9E-06   51.5  -1.1   74    3-76    164-253 (699)
  9 KOG1832 HIV-1 Vpr-binding prot  84.0    0.59 1.3E-05   49.3   1.9   13   41-53   1358-1370(1516)
 10 smart00336 BBOX B-Box-type zin  83.7    0.66 1.4E-05   28.8   1.4   34   42-78      2-35  (42)
 11 cd00021 BBOX B-Box-type zinc f  79.1    0.87 1.9E-05   27.9   0.7   31   45-78      2-32  (39)
 12 PTZ00415 transmission-blocking  76.4     1.5 3.2E-05   49.1   1.8   22  107-128   164-185 (2849)
 13 PF00643 zf-B_box:  B-box zinc   75.3    0.66 1.4E-05   29.4  -0.7   34   43-79      3-36  (42)
 14 PF14812 PBP1_TM:  Transmembran  72.9     1.1 2.5E-05   34.1   0.0    9  120-128    49-57  (81)
 15 PF12773 DZR:  Double zinc ribb  69.7     5.3 0.00012   26.1   2.7   30   17-52      9-38  (50)
 16 KOG3130 Uncharacterized conser  63.4     5.9 0.00013   38.6   2.7   14  163-176   338-351 (514)
 17 PTZ00415 transmission-blocking  61.9     5.3 0.00011   45.1   2.2    9   70-78    112-120 (2849)
 18 PRK14559 putative protein seri  60.0     8.3 0.00018   38.7   3.1   36    1-52      1-36  (645)
 19 PF04147 Nop14:  Nop14-like fam  55.4       9 0.00019   39.2   2.5   13  159-171   441-453 (840)
 20 KOG4032 Uncharacterized conser  53.7      10 0.00022   33.0   2.3   14  112-125   144-157 (184)
 21 PF09538 FYDLN_acid:  Protein o  51.2      33 0.00071   27.1   4.6   26   20-51      9-34  (108)
 22 PF03153 TFIIA:  Transcription   49.5     7.7 0.00017   35.1   0.9   10  115-124   326-335 (375)
 23 PF03115 Astro_capsid:  Astrovi  43.9     7.6 0.00017   40.0   0.0    7  121-127   719-725 (787)
 24 PLN02400 cellulose synthase     42.7      18  0.0004   38.6   2.5   30   45-74     38-71  (1085)
 25 PTZ00429 beta-adaptin; Provisi  40.6      16 0.00034   37.3   1.6   17  112-128   611-627 (746)
 26 PF02724 CDC45:  CDC45-like pro  39.4      25 0.00055   34.9   2.8    8   40-47     75-82  (622)
 27 KOG3540 Beta amyloid precursor  37.8      32 0.00069   34.5   3.1   10   46-55    143-152 (615)
 28 PF07649 C1_3:  C1-like domain;  34.9      16 0.00035   22.0   0.4   26    2-32      1-27  (30)
 29 TIGR00595 priA primosomal prot  33.2      38 0.00082   32.5   2.9   50   11-75    212-262 (505)
 30 KOG0468 U5 snRNP-specific prot  33.2      34 0.00074   35.8   2.6   27  101-127    34-60  (971)
 31 COG1499 NMD3 NMD protein affec  33.0      28 0.00062   32.7   1.9   44    1-51      6-51  (355)
 32 PF04889 Cwf_Cwc_15:  Cwf15/Cwc  31.9      23  0.0005   31.5   1.1   14  169-185   224-237 (244)
 33 PF07975 C1_4:  TFIIH C1-like d  29.8      25 0.00054   24.6   0.8   23   11-33     20-42  (51)
 34 PLN02189 cellulose synthase     28.6      38 0.00082   36.2   2.2   30   45-75     36-70  (1040)
 35 KOG3576 Ovo and related transc  28.6      11 0.00023   34.2  -1.6   41    3-44    119-168 (267)
 36 KOG4032 Uncharacterized conser  28.3      46 0.00099   29.0   2.3    9  115-123   153-161 (184)
 37 PLN02436 cellulose synthase A   27.1      42 0.00091   36.1   2.2   32   44-75     37-72  (1094)
 38 PF02318 FYVE_2:  FYVE-type zin  27.0      35 0.00077   26.5   1.3   42    2-51     55-102 (118)
 39 KOG1999 RNA polymerase II tran  26.8      46   0.001   35.5   2.4   43   79-121    26-89  (1024)
 40 PF14951 DUF4503:  Domain of un  26.5      43 0.00093   32.2   1.9   42    2-45    275-317 (389)
 41 KOG2462 C2H2-type Zn-finger pr  26.4      31 0.00068   31.8   1.0   70    3-73    132-222 (279)
 42 KOG1428 Inhibitor of type V ad  26.2      21 0.00045   40.6  -0.2   43    1-45   3322-3367(3738)
 43 KOG2140 Uncharacterized conser  25.5      55  0.0012   33.4   2.5   13  115-127   435-447 (739)
 44 PRK14714 DNA polymerase II lar  25.0      50  0.0011   36.2   2.3    7    2-8     668-674 (1337)
 45 PRK14873 primosome assembly pr  24.3      60  0.0013   32.7   2.6   49   11-75    382-431 (665)
 46 PF08746 zf-RING-like:  RING-li  23.5      13 0.00028   24.6  -1.5   28   20-49     11-43  (43)
 47 KOG2023 Nuclear transport rece  22.6      55  0.0012   34.2   2.0    6  116-121   362-367 (885)
 48 PRK05580 primosome assembly pr  22.1      66  0.0014   32.1   2.4   38   11-53    380-418 (679)
 49 KOG2652 RNA polymerase II tran  21.9      62  0.0013   30.7   2.0    7  160-166   320-326 (348)
 50 PF01286 XPA_N:  XPA protein N-  21.6      55  0.0012   21.3   1.2   30   20-51      3-32  (34)
 51 COG1198 PriA Primosomal protei  20.6      77  0.0017   32.6   2.6   50   11-75    434-484 (730)
 52 PF04438 zf-HIT:  HIT zinc fing  20.5      37 0.00079   21.1   0.2   23    2-24      3-25  (30)

No 1  
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=97.62  E-value=4.6e-05  Score=47.34  Aligned_cols=38  Identities=47%  Similarity=0.982  Sum_probs=33.0

Q ss_pred             CCCCCCC-CCceEEeccCccccCchhccccccCCccCCCcceeee
Q 029117            2 KKCELCG-SPAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLL   45 (198)
Q Consensus         2 ~~Cd~C~-apA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (198)
                      ..|..++ +++.|||..|++.+|..|+...|.      .|.+++|
T Consensus         1 ~~C~~H~~~~~~~fC~~~~~~iC~~C~~~~H~------~H~~~~i   39 (39)
T cd00021           1 RLCDEHGEEPLSLFCETDRALLCVDCDLSVHS------GHRRVPL   39 (39)
T ss_pred             CCCCccCCcceEEEeCccChhhhhhcChhhcC------CCCEeeC
Confidence            3688898 699999999999999999988873      6988875


No 2  
>smart00336 BBOX B-Box-type zinc finger.
Probab=97.10  E-value=0.00047  Score=43.27  Aligned_cols=39  Identities=44%  Similarity=0.821  Sum_probs=33.4

Q ss_pred             CCCCCCCC-CCceEEeccCccccCchhccccccCCccCCCcceeee
Q 029117            1 MKKCELCG-SPAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLL   45 (198)
Q Consensus         1 m~~Cd~C~-apA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (198)
                      ++.|..+. .++.+||..+.+.||..|....|      +.|.+++|
T Consensus         3 ~~~C~~h~~~~~~~~C~~c~~~iC~~C~~~~H------~~H~~~~l   42 (42)
T smart00336        3 PPKCDSHGDEPAEFFCEECGALLCRTCDEAEH------RGHTVVLL   42 (42)
T ss_pred             CCcCCCCCCCceEEECCCCCcccccccChhhc------CCCceecC
Confidence            35799999 89999999999999999998766      46887764


No 3  
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=96.98  E-value=0.00055  Score=43.76  Aligned_cols=39  Identities=28%  Similarity=0.589  Sum_probs=33.1

Q ss_pred             CCCCCCCC-CCceEEeccCccccCchhccccccCCccCCCcceeee
Q 029117            1 MKKCELCG-SPAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLL   45 (198)
Q Consensus         1 m~~Cd~C~-apA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (198)
                      ++.|..|. .++.+||..+...||..|....|..      |..++|
T Consensus         3 ~~~C~~H~~~~~~~~C~~C~~~~C~~C~~~~H~~------H~~~~i   42 (42)
T PF00643_consen    3 EPKCPEHPEEPLSLFCEDCNEPLCSECTVSGHKG------HKIVPI   42 (42)
T ss_dssp             SSB-SSTTTSBEEEEETTTTEEEEHHHHHTSTTT------SEEEEC
T ss_pred             CccCccCCccceEEEecCCCCccCccCCCCCCCC------CEEeEC
Confidence            46899999 6699999999999999999999844      887765


No 4  
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=93.71  E-value=0.026  Score=54.16  Aligned_cols=7  Identities=14%  Similarity=0.487  Sum_probs=4.0

Q ss_pred             ceeeCCC
Q 029117          122 QVVPWSS  128 (198)
Q Consensus       122 qvvpws~  128 (198)
                      -.+=|+.
T Consensus       121 d~~~WtP  127 (458)
T PF10446_consen  121 DYEFWTP  127 (458)
T ss_pred             cceeecc
Confidence            4566763


No 5  
>PF10446 DUF2457:  Protein of unknown function (DUF2457);  InterPro: IPR018853  This entry represents a family of uncharacterised proteins. 
Probab=92.98  E-value=0.068  Score=51.44  Aligned_cols=9  Identities=11%  Similarity=0.080  Sum_probs=4.3

Q ss_pred             CCCceeeCC
Q 029117          119 EENQVVPWS  127 (198)
Q Consensus       119 ~~nqvvpws  127 (198)
                      .+.-.|=|.
T Consensus        86 D~d~~~~~~   94 (458)
T PF10446_consen   86 DDDSTVHDF   94 (458)
T ss_pred             ccccccccc
Confidence            344455554


No 6  
>PF04931 DNA_pol_phi:  DNA polymerase phi;  InterPro: IPR007015 Proteins of this family are predominantly nucleolar. The majority are described as transcription factor transactivators. The family also includes the fifth essential DNA polymerase (Pol5p) of Schizosaccharomyces pombe (Fission yeast) and Saccharomyces cerevisiae (Baker's yeast) (2.7.7.7 from EC). Pol5p is localized exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units.; GO: 0003677 DNA binding, 0003887 DNA-directed DNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=90.98  E-value=0.17  Score=50.49  Aligned_cols=7  Identities=43%  Similarity=0.705  Sum_probs=2.9

Q ss_pred             ccccccc
Q 029117          175 FHSRQQD  181 (198)
Q Consensus       175 ~~~~~~~  181 (198)
                      |+-++-|
T Consensus       772 Fk~RvlD  778 (784)
T PF04931_consen  772 FKNRVLD  778 (784)
T ss_pred             HHHHHHH
Confidence            4444433


No 7  
>PF09026 CENP-B_dimeris:  Centromere protein B dimerisation domain;  InterPro: IPR015115 Centromere protein B (CENP-B) interacts with centromeric heterochromatin in chromosomes and binds to a specific subset of alphoid satellite DNA, called the CENP-B box. CENP-B may organise arrays of centromere satellite DNA into a higher order structure, which then directs centromere formation and kinetochore assembly in mammalian chromosomes. The CENP-B dimerisation domain is composed of two alpha-helices, which are folded into an antiparallel configuration. Dimerisation of CENP-B is mediated by this domain, in which monomers dimerise to form a symmetrical, antiparallel, four-helix bundle structure with a large hydrophobic patch in which 23 residues of one monomer form van der Waals contacts with the other monomer. This CENP-B dimer configuration may be suitable for capturing two distant CENP-B boxes during centromeric heterochromatin formation []. ; GO: 0003677 DNA binding, 0003682 chromatin binding, 0006355 regulation of transcription, DNA-dependent, 0000775 chromosome, centromeric region, 0005634 nucleus; PDB: 1UFI_A.
Probab=90.88  E-value=0.069  Score=42.27  Aligned_cols=8  Identities=38%  Similarity=0.493  Sum_probs=0.0

Q ss_pred             CCCCCcee
Q 029117          117 EDEENQVV  124 (198)
Q Consensus       117 ~~~~nqvv  124 (198)
                      ++.++-|-
T Consensus        37 e~de~p~p   44 (101)
T PF09026_consen   37 EEDEVPVP   44 (101)
T ss_dssp             --------
T ss_pred             ccccccch
Confidence            33355543


No 8  
>KOG4367 consensus Predicted Zn-finger protein [Function unknown]
Probab=88.66  E-value=0.088  Score=51.46  Aligned_cols=74  Identities=26%  Similarity=0.454  Sum_probs=58.0

Q ss_pred             CCCCCC-C--CceEEeccCccccCchhccccccCCccCCCcceeeecc-------------cccCCCCCcCCCCCCCCcc
Q 029117            3 KCELCG-S--PAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLLCH-------------VCQSLTPWNGSGPKLGPTI   66 (198)
Q Consensus         3 ~Cd~C~-a--pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpLC~-------------~C~s~~A~~~sG~C~~d~a   66 (198)
                      .|.+|+ +  .|.|+|.....+.|.-|..+.|-+--.+++|.-+|-.+             .|..++....+..|+.+.+
T Consensus       164 kcqlce~a~k~a~v~ceqcdv~yc~pc~~~~hp~rgplakh~l~~~~~grvs~~~s~r~~~~ct~h~~e~~smyc~~ck~  243 (699)
T KOG4367|consen  164 KCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKM  243 (699)
T ss_pred             hhhhhcCChhhhhhhHhhCceEEechHHhccCCCCCchhhcccCCcccCceeeccchhhhhhccCCCCCCceEEEEecCC
Confidence            689999 4  78999999999999999999998777788887766443             3555554334556888999


Q ss_pred             ccCcccccCC
Q 029117           67 SVCNVCVGNG   76 (198)
Q Consensus        67 sLC~sCd~~~   76 (198)
                      .+|-.|....
T Consensus       244 pvc~~clee~  253 (699)
T KOG4367|consen  244 PVCYQCLEEG  253 (699)
T ss_pred             hHHHHHHHhh
Confidence            9999996553


No 9  
>KOG1832 consensus HIV-1 Vpr-binding protein [Cell cycle control, cell division, chromosome partitioning]
Probab=84.03  E-value=0.59  Score=49.32  Aligned_cols=13  Identities=23%  Similarity=0.350  Sum_probs=5.9

Q ss_pred             ceeeecccccCCC
Q 029117           41 SRTLLCHVCQSLT   53 (198)
Q Consensus        41 ~RvpLC~~C~s~~   53 (198)
                      .|.+|-+.|-.++
T Consensus      1358 v~R~~~Dlct~~~ 1370 (1516)
T KOG1832|consen 1358 VDRCLLDLCTEPT 1370 (1516)
T ss_pred             cccchhhhhcCCc
Confidence            3334444555444


No 10 
>smart00336 BBOX B-Box-type zinc finger.
Probab=83.75  E-value=0.66  Score=28.78  Aligned_cols=34  Identities=12%  Similarity=0.004  Sum_probs=25.7

Q ss_pred             eeeecccccCCCCCcCCCCCCCCccccCcccccCCCC
Q 029117           42 RTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGNGSG   78 (198)
Q Consensus        42 RvpLC~~C~s~~A~~~sG~C~~d~asLC~sCd~~~h~   78 (198)
                      |.++|..+...+..++   |..+...||..|....|.
T Consensus         2 ~~~~C~~h~~~~~~~~---C~~c~~~iC~~C~~~~H~   35 (42)
T smart00336        2 RPPKCDSHGDEPAEFF---CEECGALLCRTCDEAEHR   35 (42)
T ss_pred             cCCcCCCCCCCceEEE---CCCCCcccccccChhhcC
Confidence            5677888875444443   899999999999877664


No 11 
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=79.12  E-value=0.87  Score=27.86  Aligned_cols=31  Identities=13%  Similarity=-0.050  Sum_probs=22.9

Q ss_pred             ecccccCCCCCcCCCCCCCCccccCcccccCCCC
Q 029117           45 LCHVCQSLTPWNGSGPKLGPTISVCNVCVGNGSG   78 (198)
Q Consensus        45 LC~~C~s~~A~~~sG~C~~d~asLC~sCd~~~h~   78 (198)
                      +|..+...+..++   |..+.+.||..|....|.
T Consensus         2 ~C~~H~~~~~~~f---C~~~~~~iC~~C~~~~H~   32 (39)
T cd00021           2 LCDEHGEEPLSLF---CETDRALLCVDCDLSVHS   32 (39)
T ss_pred             CCCccCCcceEEE---eCccChhhhhhcChhhcC
Confidence            4666655343443   899999999999988775


No 12 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=76.35  E-value=1.5  Score=49.12  Aligned_cols=22  Identities=32%  Similarity=0.746  Sum_probs=13.4

Q ss_pred             CCCCCCCCCCCCCCCceeeCCC
Q 029117          107 DDDDDGGDEDEDEENQVVPWSS  128 (198)
Q Consensus       107 ~~~~~~~~~~~~~~nqvvpws~  128 (198)
                      ||+++|++|+++++-||-|+--
T Consensus       164 ~~~~~~~~e~~~~~~~~~~~~d  185 (2849)
T PTZ00415        164 DDDEEDDEEEEEEEEEIKGFDD  185 (2849)
T ss_pred             ccccccccccccccccccCCCc
Confidence            3344445555666668888874


No 13 
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=75.30  E-value=0.66  Score=29.37  Aligned_cols=34  Identities=12%  Similarity=0.031  Sum_probs=25.2

Q ss_pred             eeecccccCCCCCcCCCCCCCCccccCcccccCCCCC
Q 029117           43 TLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGNGSGS   79 (198)
Q Consensus        43 vpLC~~C~s~~A~~~sG~C~~d~asLC~sCd~~~h~~   79 (198)
                      .++|..+....+.++   |..+...||..|...+|.+
T Consensus         3 ~~~C~~H~~~~~~~~---C~~C~~~~C~~C~~~~H~~   36 (42)
T PF00643_consen    3 EPKCPEHPEEPLSLF---CEDCNEPLCSECTVSGHKG   36 (42)
T ss_dssp             SSB-SSTTTSBEEEE---ETTTTEEEEHHHHHTSTTT
T ss_pred             CccCccCCccceEEE---ecCCCCccCccCCCCCCCC
Confidence            456777776544443   9999999999999998863


No 14 
>PF14812 PBP1_TM:  Transmembrane domain of transglycosylase PBP1 at N-terminal; PDB: 3FWL_A 3VMA_A.
Probab=72.91  E-value=1.1  Score=34.12  Aligned_cols=9  Identities=22%  Similarity=0.464  Sum_probs=0.0

Q ss_pred             CCceeeCCC
Q 029117          120 ENQVVPWSS  128 (198)
Q Consensus       120 ~nqvvpws~  128 (198)
                      |.+.||+-.
T Consensus        49 eee~m~rK~   57 (81)
T PF14812_consen   49 EEEPMPRKG   57 (81)
T ss_dssp             ---------
T ss_pred             hcccccccc
Confidence            444667754


No 15 
>PF12773 DZR:  Double zinc ribbon
Probab=69.73  E-value=5.3  Score=26.13  Aligned_cols=30  Identities=20%  Similarity=0.526  Sum_probs=20.6

Q ss_pred             cCccccCchhccccccCCccCCCcceeeecccccCC
Q 029117           17 SDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSL   52 (198)
Q Consensus        17 aD~A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s~   52 (198)
                      .+.+.+|..|...+-      .......+|..|...
T Consensus         9 ~~~~~fC~~CG~~l~------~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen    9 PDDAKFCPHCGTPLP------PPDQSKKICPNCGAE   38 (50)
T ss_pred             CccccCChhhcCChh------hccCCCCCCcCCcCC
Confidence            445788888877766      334556678888764


No 16 
>KOG3130 consensus Uncharacterized conserved protein [Function unknown]
Probab=63.43  E-value=5.9  Score=38.62  Aligned_cols=14  Identities=21%  Similarity=-0.021  Sum_probs=9.2

Q ss_pred             cchhhhhccccccc
Q 029117          163 FSLKHVRNEITKFH  176 (198)
Q Consensus       163 ~~lkr~r~~~~~~~  176 (198)
                      .+.||.|++.+-+.
T Consensus       338 ~~~~r~~~~stG~~  351 (514)
T KOG3130|consen  338 EEAKRKRKNSTGSG  351 (514)
T ss_pred             hHHHHHHhcccccc
Confidence            34568888777554


No 17 
>PTZ00415 transmission-blocking target antigen s230; Provisional
Probab=61.87  E-value=5.3  Score=45.06  Aligned_cols=9  Identities=22%  Similarity=0.217  Sum_probs=5.6

Q ss_pred             cccccCCCC
Q 029117           70 NVCVGNGSG   78 (198)
Q Consensus        70 ~sCd~~~h~   78 (198)
                      ..|--++|+
T Consensus       112 ~~~~y~~~g  120 (2849)
T PTZ00415        112 ITCFYPIHG  120 (2849)
T ss_pred             cceeeeccc
Confidence            456666665


No 18 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=60.05  E-value=8.3  Score=38.66  Aligned_cols=36  Identities=22%  Similarity=0.604  Sum_probs=23.1

Q ss_pred             CCCCCCCCCCceEEeccCccccCchhccccccCCccCCCcceeeecccccCC
Q 029117            1 MKKCELCGSPAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQSL   52 (198)
Q Consensus         1 m~~Cd~C~apA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s~   52 (198)
                      |.+|-.|++.     -.+.+++|..|.+++-        |   ..|..|...
T Consensus         1 M~~Cp~Cg~~-----n~~~akFC~~CG~~l~--------~---~~Cp~CG~~   36 (645)
T PRK14559          1 MLICPQCQFE-----NPNNNRFCQKCGTSLT--------H---KPCPQCGTE   36 (645)
T ss_pred             CCcCCCCCCc-----CCCCCccccccCCCCC--------C---CcCCCCCCC
Confidence            8899999922     1345677777766652        1   247777764


No 19 
>PF04147 Nop14:  Nop14-like family ;  InterPro: IPR007276 Emg1 and Nop14 are novel proteins whose interaction is required for the maturation of the 18S rRNA and for 40S ribosome production [].
Probab=55.45  E-value=9  Score=39.23  Aligned_cols=13  Identities=8%  Similarity=0.181  Sum_probs=8.2

Q ss_pred             cccccchhhhhcc
Q 029117          159 SQMSFSLKHVRNE  171 (198)
Q Consensus       159 ~~~~~~lkr~r~~  171 (198)
                      ....+-++|+|..
T Consensus       441 ~~~~~iI~RIrk~  453 (840)
T PF04147_consen  441 EDQPTIIQRIRKC  453 (840)
T ss_pred             HHHhHHHHHHHHh
Confidence            3456667777764


No 20 
>KOG4032 consensus Uncharacterized conserved protein [Function unknown]
Probab=53.73  E-value=10  Score=32.96  Aligned_cols=14  Identities=36%  Similarity=0.610  Sum_probs=6.8

Q ss_pred             CCCCCCCCCCceee
Q 029117          112 GGDEDEDEENQVVP  125 (198)
Q Consensus       112 ~~~~~~~~~nqvvp  125 (198)
                      .+|++.+.+|+=+|
T Consensus       144 ~dd~evdae~~~~~  157 (184)
T KOG4032|consen  144 EDDEEVDAEDDEAP  157 (184)
T ss_pred             chhhhhcccCCCCC
Confidence            34445555555444


No 21 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=51.22  E-value=33  Score=27.09  Aligned_cols=26  Identities=27%  Similarity=0.574  Sum_probs=19.4

Q ss_pred             cccCchhccccccCCccCCCcceeeecccccC
Q 029117           20 ASLCWDCDAKVHGANFLVANHSRTLLCHVCQS   51 (198)
Q Consensus        20 A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s   51 (198)
                      ..+|..|.++..--|+      +..+|..|+.
T Consensus         9 KR~Cp~CG~kFYDLnk------~PivCP~CG~   34 (108)
T PF09538_consen    9 KRTCPSCGAKFYDLNK------DPIVCPKCGT   34 (108)
T ss_pred             cccCCCCcchhccCCC------CCccCCCCCC
Confidence            4689999999887662      4456888885


No 22 
>PF03153 TFIIA:  Transcription factor IIA, alpha/beta subunit;  InterPro: IPR004855 Transcription factor IIA (TFIIA) is one of several factors that form part of a transcription pre-initiation complex along with RNA polymerase II, the TATA-box-binding protein (TBP) and TBP-associated factors, on the TATA-box sequence upstream of the initiation start site. After initiation, some components of the pre-initiation complex (including TFIIA) remain attached and re-initiate a subsequent round of transcription. TFIIA binds to TBP to stabilise TBP binding to the TATA element. TFIIA also inhibits the cytokine HMGB1 (high mobility group 1 protein) binding to TBP [], and can dissociate HMGB1 already bound to TBP/TATA-box. Human and Drosophila TFIIA have three subunits: two large subunits, LN/alpha and LC/beta, derived from the same gene, and a small subunit, S/gamma. Yeast TFIIA has two subunits: a large TOA1 subunit that shows sequence similarity to the N-terminal of LN/alpha and the C-terminal of LC/beta, and a small subunit, TOA2 that is highly homologous with S/gamma. The conserved regions of the large and small subunits of TFIIA combine to form two domains: a four-helix bundle (helical domain) composed of two helices from each of the N-terminal regions of TOA1 and TOA2 in yeast; and a beta-barrel (beta-barrel domain) composed of beta-sheets from the C-terminal regions of TOA1 and TOA2 []. This entry represents the precursor that yields both the alpha and beta subunits of TFIIA. The TFIIA heterotrimer is an essential general transcription initiation factor for the expression of genes transcribed by RNA polymerase II []. ; GO: 0006367 transcription initiation from RNA polymerase II promoter, 0005672 transcription factor TFIIA complex; PDB: 1NVP_B 1YTF_B 1RM1_C 1NH2_B.
Probab=49.47  E-value=7.7  Score=35.11  Aligned_cols=10  Identities=40%  Similarity=0.611  Sum_probs=3.5

Q ss_pred             CCCCCCCcee
Q 029117          115 EDEDEENQVV  124 (198)
Q Consensus       115 ~~~~~~nqvv  124 (198)
                      ++++.+|-||
T Consensus       326 ~~~~~~~~~~  335 (375)
T PF03153_consen  326 DDFDTDNVVL  335 (375)
T ss_dssp             --STTS-EEE
T ss_pred             cccCcCCEEE
Confidence            3345555554


No 23 
>PF03115 Astro_capsid:  Astrovirus capsid protein precursor;  InterPro: IPR004337 The astrovirus genome is apparently organised with nonstructural proteins encoded at the 5' end and structural proteins at the 3' end []. Proteins in this family are encoded by astrovirus ORF2, one of the three astrovirus ORFs (1a, 1b, 2). The proteins contain a viral RNA-dependent RNA polymerase motif []. The 87kDa precursor polyprotein undergoes an intracellular cleavage to form a 79kDa protein. Subsequently, extracellular trypsin cleavage yields the three proteins forming the infectious virion [].; PDB: 3QSQ_A 3TS3_D.
Probab=43.87  E-value=7.6  Score=39.99  Aligned_cols=7  Identities=43%  Similarity=0.468  Sum_probs=0.0

Q ss_pred             CceeeCC
Q 029117          121 NQVVPWS  127 (198)
Q Consensus       121 nqvvpws  127 (198)
                      ||=+|=.
T Consensus       719 NqGi~ee  725 (787)
T PF03115_consen  719 NQGIPEE  725 (787)
T ss_dssp             -------
T ss_pred             HcCCCHH
Confidence            5555544


No 24 
>PLN02400 cellulose synthase
Probab=42.73  E-value=18  Score=38.63  Aligned_cols=30  Identities=17%  Similarity=0.389  Sum_probs=19.6

Q ss_pred             ecccccCCCCCcCC----CCCCCCccccCccccc
Q 029117           45 LCHVCQSLTPWNGS----GPKLGPTISVCNVCVG   74 (198)
Q Consensus        45 LC~~C~s~~A~~~s----G~C~~d~asLC~sCd~   74 (198)
                      +|++|...-.....    -+|..++..+|..|..
T Consensus        38 iCqICGD~VG~t~dGe~FVAC~eCaFPVCRpCYE   71 (1085)
T PLN02400         38 ICQICGDDVGVTETGDVFVACNECAFPVCRPCYE   71 (1085)
T ss_pred             eeeecccccCcCCCCCEEEEEccCCCccccchhh
Confidence            79999853211111    2588899899988864


No 25 
>PTZ00429 beta-adaptin; Provisional
Probab=40.58  E-value=16  Score=37.27  Aligned_cols=17  Identities=24%  Similarity=0.110  Sum_probs=10.5

Q ss_pred             CCCCCCCCCCceeeCCC
Q 029117          112 GGDEDEDEENQVVPWSS  128 (198)
Q Consensus       112 ~~~~~~~~~nqvvpws~  128 (198)
                      |++||++++||+-|-+.
T Consensus       611 ~~~~~~~~~~~~~~~~~  627 (746)
T PTZ00429        611 EDTEDDDAVELPSTPSM  627 (746)
T ss_pred             ccccchhhccCCCCCCC
Confidence            33456667777766654


No 26 
>PF02724 CDC45:  CDC45-like protein;  InterPro: IPR003874 CDC45 is an essential gene required for initiation of DNA replication in Saccharomyces cerevisiae (cell division control protein 45), forming a complex with MCM5/CDC46. Homologs of CDC45 have been identified in human [], mouse and the smut fungus, Melampsora spp., (tsd2 protein) among others.; GO: 0006270 DNA-dependent DNA replication initiation
Probab=39.42  E-value=25  Score=34.86  Aligned_cols=8  Identities=0%  Similarity=-0.010  Sum_probs=3.4

Q ss_pred             cceeeecc
Q 029117           40 HSRTLLCH   47 (198)
Q Consensus        40 H~RvpLC~   47 (198)
                      +.++.+++
T Consensus        75 ~~~iyViD   82 (622)
T PF02724_consen   75 DVTIYVID   82 (622)
T ss_pred             ceEEEEEe
Confidence            44444443


No 27 
>KOG3540 consensus Beta amyloid precursor protein [General function prediction only]
Probab=37.81  E-value=32  Score=34.48  Aligned_cols=10  Identities=20%  Similarity=0.740  Sum_probs=5.2

Q ss_pred             cccccCCCCC
Q 029117           46 CHVCQSLTPW   55 (198)
Q Consensus        46 C~~C~s~~A~   55 (198)
                      |+.|+.+..|
T Consensus       143 mD~cEn~~hw  152 (615)
T KOG3540|consen  143 MDQCENNQHW  152 (615)
T ss_pred             cccccchHHH
Confidence            5556554443


No 28 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=34.85  E-value=16  Score=22.02  Aligned_cols=26  Identities=27%  Similarity=0.644  Sum_probs=8.6

Q ss_pred             CCCCCCC-CCceEEeccCccccCchhcccccc
Q 029117            2 KKCELCG-SPAKMFCESDQASLCWDCDAKVHG   32 (198)
Q Consensus         2 ~~Cd~C~-apA~vyC~aD~A~LC~~CDa~VHs   32 (198)
                      +.|++|+ ..-.     ...+-|..||..+|.
T Consensus         1 ~~C~~C~~~~~~-----~~~Y~C~~Cdf~lH~   27 (30)
T PF07649_consen    1 FRCDACGKPIDG-----GWFYRCSECDFDLHE   27 (30)
T ss_dssp             ---TTTS----S-------EEE-TTT-----H
T ss_pred             CcCCcCCCcCCC-----CceEECccCCCccCh
Confidence            3688999 3221     124668888888873


No 29 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=33.22  E-value=38  Score=32.55  Aligned_cols=50  Identities=24%  Similarity=0.535  Sum_probs=32.5

Q ss_pred             ceEEeccCc-cccCchhccccccCCccCCCcceeeecccccCCCCCcCCCCCCCCccccCcccccC
Q 029117           11 AKMFCESDQ-ASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGN   75 (198)
Q Consensus        11 A~vyC~aD~-A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s~~A~~~sG~C~~d~asLC~sCd~~   75 (198)
                      ..|+|+.+. ..-|..||...-.     .++.+.+.|..|....+.          -..|..|...
T Consensus       212 ~~~~C~~Cg~~~~C~~C~~~l~~-----h~~~~~l~Ch~Cg~~~~~----------~~~Cp~C~s~  262 (505)
T TIGR00595       212 KNLLCRSCGYILCCPNCDVSLTY-----HKKEGKLRCHYCGYQEPI----------PKTCPQCGSE  262 (505)
T ss_pred             CeeEhhhCcCccCCCCCCCceEE-----ecCCCeEEcCCCcCcCCC----------CCCCCCCCCC
Confidence            456788774 6779999865432     245668899999865432          1257777553


No 30 
>KOG0468 consensus U5 snRNP-specific protein [Translation, ribosomal structure and biogenesis]
Probab=33.18  E-value=34  Score=35.80  Aligned_cols=27  Identities=30%  Similarity=0.609  Sum_probs=15.0

Q ss_pred             ccCCCCCCCCCCCCCCCCCCCceeeCC
Q 029117          101 EEEDDDDDDDDGGDEDEDEENQVVPWS  127 (198)
Q Consensus       101 e~~~~~~~~~~~~~~~~~~~nqvvpws  127 (198)
                      |.+.+++++......|++..||||=-.
T Consensus        34 e~~~~d~~e~~~~~~e~~~~~~vvLhe   60 (971)
T KOG0468|consen   34 EVDQDDEDEMEGDHNEDEPQNAVVLHE   60 (971)
T ss_pred             hccCCcccccccccccccccceeeecc
Confidence            333333333333455666789998665


No 31 
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=32.97  E-value=28  Score=32.66  Aligned_cols=44  Identities=23%  Similarity=0.478  Sum_probs=30.9

Q ss_pred             CCCCCCCC-CC-ceEEeccCccccCchhccccccCCccCCCcceeeecccccC
Q 029117            1 MKKCELCG-SP-AKMFCESDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQS   51 (198)
Q Consensus         1 m~~Cd~C~-ap-A~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s   51 (198)
                      |.+|-.|+ .. +.      .+.||..|....|. +.-..+-..+.+|..|.+
T Consensus         6 ~~~C~~CGr~~~~~------~~~lC~dC~~~~~~-~~~ip~~~~v~~C~~Cga   51 (355)
T COG1499           6 TILCVRCGRSVDPL------IDGLCGDCYVETTP-LIEIPDEVNVEVCRHCGA   51 (355)
T ss_pred             ccEeccCCCcCchh------hccccHHHHhccCc-cccCCCceEEEECCcCCC
Confidence            45788888 33 33      38999999999773 223345667788999985


No 32 
>PF04889 Cwf_Cwc_15:  Cwf15/Cwc15 cell cycle control protein;  InterPro: IPR006973 This family represents Cwf15/Cwc15 (from Schizosaccharomyces pombe and Saccharomyces cerevisiae respectively) and their homologues. The function of these proteins is unknown, but they form part of the spliceosome and are thus thought to be involved in mRNA splicing [].; GO: 0000398 nuclear mRNA splicing, via spliceosome, 0005681 spliceosomal complex
Probab=31.88  E-value=23  Score=31.47  Aligned_cols=14  Identities=21%  Similarity=0.309  Sum_probs=8.5

Q ss_pred             hcccccccccccccccc
Q 029117          169 RNEITKFHSRQQDYHQG  185 (198)
Q Consensus       169 r~~~~~~~~~~~~~~~~  185 (198)
                      +=-++.|+|   |||+-
T Consensus       224 ~fiND~~rS---dfH~k  237 (244)
T PF04889_consen  224 EFINDTLRS---DFHKK  237 (244)
T ss_pred             CcccCCccc---HHHHH
Confidence            344566777   67753


No 33 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=29.76  E-value=25  Score=24.62  Aligned_cols=23  Identities=26%  Similarity=0.690  Sum_probs=15.6

Q ss_pred             ceEEeccCccccCchhccccccC
Q 029117           11 AKMFCESDQASLCWDCDAKVHGA   33 (198)
Q Consensus        11 A~vyC~aD~A~LC~~CDa~VHsA   33 (198)
                      .++-|......+|..||.-||..
T Consensus        20 ~~y~C~~C~~~FC~dCD~fiHE~   42 (51)
T PF07975_consen   20 SRYRCPKCKNHFCIDCDVFIHET   42 (51)
T ss_dssp             EEE--TTTT--B-HHHHHTTTTT
T ss_pred             CeEECCCCCCccccCcChhhhcc
Confidence            46889999999999999999954


No 34 
>PLN02189 cellulose synthase
Probab=28.64  E-value=38  Score=36.23  Aligned_cols=30  Identities=17%  Similarity=0.208  Sum_probs=19.3

Q ss_pred             ecccccCCCC-----CcCCCCCCCCccccCcccccC
Q 029117           45 LCHVCQSLTP-----WNGSGPKLGPTISVCNVCVGN   75 (198)
Q Consensus        45 LC~~C~s~~A-----~~~sG~C~~d~asLC~sCd~~   75 (198)
                      +|.+|...-.     ..+ -+|..++-.+|..|..-
T Consensus        36 ~C~iCgd~vg~~~~g~~f-vaC~~C~fpvCr~Cyey   70 (1040)
T PLN02189         36 VCEICGDEIGLTVDGDLF-VACNECGFPVCRPCYEY   70 (1040)
T ss_pred             cccccccccCcCCCCCEE-EeeccCCCccccchhhh
Confidence            7888875311     111 25888888888888643


No 35 
>KOG3576 consensus Ovo and related transcription factors [Transcription]
Probab=28.62  E-value=11  Score=34.19  Aligned_cols=41  Identities=32%  Similarity=0.709  Sum_probs=31.8

Q ss_pred             CCCCCC-C-------CceEEeccC-ccccCchhccccccCCccCCCcceee
Q 029117            3 KCELCG-S-------PAKMFCESD-QASLCWDCDAKVHGANFLVANHSRTL   44 (198)
Q Consensus         3 ~Cd~C~-a-------pA~vyC~aD-~A~LC~~CDa~VHsAN~La~rH~Rvp   44 (198)
                      .|.+|+ .       .--|-|++| ..+||..|.+..|-+ +-++||+|.-
T Consensus       119 tCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfndt-fdlkrh~rth  168 (267)
T KOG3576|consen  119 TCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFNDT-FDLKRHTRTH  168 (267)
T ss_pred             eeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccch-hhhhhhhccc
Confidence            577887 2       224679999 689999999999954 6679999874


No 36 
>KOG4032 consensus Uncharacterized conserved protein [Function unknown]
Probab=28.29  E-value=46  Score=29.05  Aligned_cols=9  Identities=33%  Similarity=0.520  Sum_probs=3.8

Q ss_pred             CCCCCCCce
Q 029117          115 EDEDEENQV  123 (198)
Q Consensus       115 ~~~~~~nqv  123 (198)
                      .++..-++|
T Consensus       153 ~~~~~~~~~  161 (184)
T KOG4032|consen  153 DDEAPSGPV  161 (184)
T ss_pred             CCCCCCCCC
Confidence            333444444


No 37 
>PLN02436 cellulose synthase A
Probab=27.12  E-value=42  Score=36.10  Aligned_cols=32  Identities=16%  Similarity=0.292  Sum_probs=20.4

Q ss_pred             eecccccCCCCCcCC----CCCCCCccccCcccccC
Q 029117           44 LLCHVCQSLTPWNGS----GPKLGPTISVCNVCVGN   75 (198)
Q Consensus        44 pLC~~C~s~~A~~~s----G~C~~d~asLC~sCd~~   75 (198)
                      .+|++|...-.....    -+|..++-.+|..|..-
T Consensus        37 ~iCqICGD~Vg~t~dGe~FVACn~C~fpvCr~Cyey   72 (1094)
T PLN02436         37 QTCQICGDEIELTVDGEPFVACNECAFPVCRPCYEY   72 (1094)
T ss_pred             ccccccccccCcCCCCCEEEeeccCCCccccchhhh
Confidence            389999853211111    25888888999988643


No 38 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=27.00  E-value=35  Score=26.46  Aligned_cols=42  Identities=26%  Similarity=0.700  Sum_probs=29.1

Q ss_pred             CCCCCCCC------CceEEeccCccccCchhccccccCCccCCCcceeeecccccC
Q 029117            2 KKCELCGS------PAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLLCHVCQS   51 (198)
Q Consensus         2 ~~Cd~C~a------pA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s   51 (198)
                      ..|-.|+.      .....|.......|..|...        .+....|||-+|..
T Consensus        55 ~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~--------~~~~~~WlC~vC~k  102 (118)
T PF02318_consen   55 RHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVY--------SKKEPIWLCKVCQK  102 (118)
T ss_dssp             SB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEE--------TSSSCCEEEHHHHH
T ss_pred             cchhhhCCcccccCCCCCcCCcCCccccCccCCc--------CCCCCCEEChhhHH
Confidence            35777762      34577888888888888766        34567889988874


No 39 
>KOG1999 consensus RNA polymerase II transcription elongation factor DSIF/SUPT5H/SPT5 [Transcription]
Probab=26.78  E-value=46  Score=35.52  Aligned_cols=43  Identities=28%  Similarity=0.553  Sum_probs=0.0

Q ss_pred             CCccccccCCCCCCCCCCCccCccCCCC---------------------CCCCCCCCCCCCCCC
Q 029117           79 STSREETNRGETYTDDDYDDANEEEDDD---------------------DDDDDGGDEDEDEEN  121 (198)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~d~de~~~~~---------------------~~~~~~~~~~~~~~n  121 (198)
                      +..+.....++.++|.+.++.++.++++                     |||.+++++++|+|+
T Consensus        26 ~~s~~~~~~~~~~de~D~~e~~e~~~dd~~~~~~k~~s~~gf~~~e~dvDdeveddd~~~edEe   89 (1024)
T KOG1999|consen   26 GESNSPADDEDTEDEGDEEEYDEDRKDDEPDEKDKKESGGGFIDREADVDDEVEDDDDDEEDEE   89 (1024)
T ss_pred             ccccCCCccccccccccchhhcccccCcchhhhccccccccccccccccccccccccchhccCc


No 40 
>PF14951 DUF4503:  Domain of unknown function (DUF4503)
Probab=26.48  E-value=43  Score=32.19  Aligned_cols=42  Identities=26%  Similarity=0.430  Sum_probs=32.6

Q ss_pred             CCCCCCCCCceEEeccC-ccccCchhccccccCCccCCCcceeee
Q 029117            2 KKCELCGSPAKMFCESD-QASLCWDCDAKVHGANFLVANHSRTLL   45 (198)
Q Consensus         2 ~~Cd~C~apA~vyC~aD-~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (198)
                      |.|+.|++.-.-....| .++.|..|..-|-  ++++++|.-|-|
T Consensus       275 PvCd~CGn~rLe~~pe~rg~~~C~~Cs~~V~--sP~~r~~LeVfl  317 (389)
T PF14951_consen  275 PVCDRCGNGRLEQSPEDRGAFSCGDCSRVVT--SPVLRMHLEVFL  317 (389)
T ss_pred             ccccccCCccceeCccCCCceeccchhhhcc--CcceeeeEEEEE
Confidence            58999994444444444 5799999999887  789999998876


No 41 
>KOG2462 consensus C2H2-type Zn-finger protein [Transcription]
Probab=26.41  E-value=31  Score=31.76  Aligned_cols=70  Identities=29%  Similarity=0.452  Sum_probs=46.5

Q ss_pred             CCCCCC-CCce---------EEeccC--ccccCchhccccccCCccCCCcceee----ecccccC--CCCCcCCCCCC--
Q 029117            3 KCELCG-SPAK---------MFCESD--QASLCWDCDAKVHGANFLVANHSRTL----LCHVCQS--LTPWNGSGPKL--   62 (198)
Q Consensus         3 ~Cd~C~-apA~---------vyC~aD--~A~LC~~CDa~VHsAN~La~rH~Rvp----LC~~C~s--~~A~~~sG~C~--   62 (198)
                      .|.-|+ .-|+         ++|..|  .|+-|..|++.-=+- +.+++|.|+-    .|.+|..  -.+|+.-|--.  
T Consensus       132 ~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSm-pALkMHirTH~l~c~C~iCGKaFSRPWLLQGHiRTH  210 (279)
T KOG2462|consen  132 KCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSM-PALKMHIRTHTLPCECGICGKAFSRPWLLQGHIRTH  210 (279)
T ss_pred             eccccccccccccccchhhcccccccccccccCCCCCceeeeh-HHHhhHhhccCCCcccccccccccchHHhhcccccc
Confidence            466677 3332         567777  588999999766544 4468899975    4888874  23677544322  


Q ss_pred             -CCccccCcccc
Q 029117           63 -GPTISVCNVCV   73 (198)
Q Consensus        63 -~d~asLC~sCd   73 (198)
                       +..-+.|+.|-
T Consensus       211 TGEKPF~C~hC~  222 (279)
T KOG2462|consen  211 TGEKPFSCPHCG  222 (279)
T ss_pred             cCCCCccCCccc
Confidence             56778888883


No 42 
>KOG1428 consensus Inhibitor of type V adenylyl cyclases/Neuronal presynaptic protein Highwire/PAM/RPM-1 [Signal transduction mechanisms]
Probab=26.16  E-value=21  Score=40.59  Aligned_cols=43  Identities=28%  Similarity=0.555  Sum_probs=31.1

Q ss_pred             CCCCCCCC---CCceEEeccCccccCchhccccccCCccCCCcceeee
Q 029117            1 MKKCELCG---SPAKMFCESDQASLCWDCDAKVHGANFLVANHSRTLL   45 (198)
Q Consensus         1 m~~Cd~C~---apA~vyC~aD~A~LC~~CDa~VHsAN~La~rH~RvpL   45 (198)
                      ||.|+.-.   ..|.|+|.-+. .||..||.-.|-.- -.+.|+|-.+
T Consensus      3322 ~PmCdNHDDG~TaA~ilC~~C~-nLCtdC~~~lHLHr-rtktH~~q~f 3367 (3738)
T KOG1428|consen 3322 MPMCDNHDDGETAAIILCNVCG-NLCTDCDRFLHLHR-RTKTHQRQVF 3367 (3738)
T ss_pred             CCcccCCCCCceeEEEehhhhh-hhHHHHHHHHHHHh-hccchhhhhh
Confidence            78898887   46788887776 99999998776321 1356887544


No 43 
>KOG2140 consensus Uncharacterized conserved protein [General function prediction only]
Probab=25.47  E-value=55  Score=33.41  Aligned_cols=13  Identities=23%  Similarity=0.570  Sum_probs=5.9

Q ss_pred             CCCCCCCceeeCC
Q 029117          115 EDEDEENQVVPWS  127 (198)
Q Consensus       115 ~~~~~~nqvvpws  127 (198)
                      |++++--||.--+
T Consensus       435 ee~~e~~qI~D~T  447 (739)
T KOG2140|consen  435 EEDEEKLQIIDMT  447 (739)
T ss_pred             ccccccceeeccc
Confidence            3333355555443


No 44 
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=24.96  E-value=50  Score=36.25  Aligned_cols=7  Identities=43%  Similarity=1.540  Sum_probs=4.9

Q ss_pred             CCCCCCC
Q 029117            2 KKCELCG    8 (198)
Q Consensus         2 ~~Cd~C~    8 (198)
                      ++|..|+
T Consensus       668 rkCPkCG  674 (1337)
T PRK14714        668 RRCPSCG  674 (1337)
T ss_pred             EECCCCC
Confidence            4677777


No 45 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=24.27  E-value=60  Score=32.69  Aligned_cols=49  Identities=18%  Similarity=0.415  Sum_probs=32.5

Q ss_pred             ceEEeccC-ccccCchhccccccCCccCCCcceeeecccccCCCCCcCCCCCCCCccccCcccccC
Q 029117           11 AKMFCESD-QASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGN   75 (198)
Q Consensus        11 A~vyC~aD-~A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s~~A~~~sG~C~~d~asLC~sCd~~   75 (198)
                      ..|+|+.+ ...-|..|+...-.     .+..+.+.|..|.....           -..|..|-..
T Consensus       382 p~l~C~~Cg~~~~C~~C~~~L~~-----h~~~~~l~Ch~CG~~~~-----------p~~Cp~Cgs~  431 (665)
T PRK14873        382 PSLACARCRTPARCRHCTGPLGL-----PSAGGTPRCRWCGRAAP-----------DWRCPRCGSD  431 (665)
T ss_pred             CeeEhhhCcCeeECCCCCCceeE-----ecCCCeeECCCCcCCCc-----------CccCCCCcCC
Confidence            46788888 47889999865532     13456788999986421           2357777554


No 46 
>PF08746 zf-RING-like:  RING-like domain;  InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO). ; PDB: 3NW0_A 2CT0_A.
Probab=23.51  E-value=13  Score=24.62  Aligned_cols=28  Identities=25%  Similarity=0.723  Sum_probs=12.1

Q ss_pred             cccCc--hhcccccc---CCccCCCcceeeecccc
Q 029117           20 ASLCW--DCDAKVHG---ANFLVANHSRTLLCHVC   49 (198)
Q Consensus        20 A~LC~--~CDa~VHs---AN~La~rH~RvpLC~~C   49 (198)
                      ..+|.  .|..++|.   +++  .+|++.+.|..|
T Consensus        11 G~~C~~~~C~~r~H~~C~~~y--~r~~~~~~CP~C   43 (43)
T PF08746_consen   11 GQRCSNRDCNVRLHDDCFKKY--FRHRSNPKCPNC   43 (43)
T ss_dssp             SEE-SS--S--EE-HHHHHHH--TTT-SS-B-TTT
T ss_pred             eccCCCCccCchHHHHHHHHH--HhcCCCCCCcCC
Confidence            56677  69999995   333  356666667665


No 47 
>KOG2023 consensus Nuclear transport receptor Karyopherin-beta2/Transportin (importin beta superfamily) [Nuclear structure; Intracellular trafficking, secretion, and vesicular transport]
Probab=22.64  E-value=55  Score=34.17  Aligned_cols=6  Identities=33%  Similarity=0.506  Sum_probs=2.4

Q ss_pred             CCCCCC
Q 029117          116 DEDEEN  121 (198)
Q Consensus       116 ~~~~~n  121 (198)
                      |+|..+
T Consensus       362 DdD~~~  367 (885)
T KOG2023|consen  362 DDDAFS  367 (885)
T ss_pred             cccccc
Confidence            444433


No 48 
>PRK05580 primosome assembly protein PriA; Validated
Probab=22.10  E-value=66  Score=32.05  Aligned_cols=38  Identities=26%  Similarity=0.522  Sum_probs=26.3

Q ss_pred             ceEEeccCc-cccCchhccccccCCccCCCcceeeecccccCCC
Q 029117           11 AKMFCESDQ-ASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLT   53 (198)
Q Consensus        11 A~vyC~aD~-A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s~~   53 (198)
                      ..++|+.+. ..-|..|+.....     .+..+.++|..|....
T Consensus       380 ~~~~C~~Cg~~~~C~~C~~~l~~-----h~~~~~l~Ch~Cg~~~  418 (679)
T PRK05580        380 PFLLCRDCGWVAECPHCDASLTL-----HRFQRRLRCHHCGYQE  418 (679)
T ss_pred             CceEhhhCcCccCCCCCCCceeE-----ECCCCeEECCCCcCCC
Confidence            457777775 5568889865432     2456788999999754


No 49 
>KOG2652 consensus RNA polymerase II transcription initiation factor TFIIA, large chain [Transcription]
Probab=21.87  E-value=62  Score=30.75  Aligned_cols=7  Identities=29%  Similarity=0.244  Sum_probs=2.7

Q ss_pred             ccccchh
Q 029117          160 QMSFSLK  166 (198)
Q Consensus       160 ~~~~~lk  166 (198)
                      +--+.||
T Consensus       320 KWKc~LK  326 (348)
T KOG2652|consen  320 KWKCYLK  326 (348)
T ss_pred             eeeEEee
Confidence            3333443


No 50 
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=21.60  E-value=55  Score=21.27  Aligned_cols=30  Identities=17%  Similarity=0.447  Sum_probs=15.5

Q ss_pred             cccCchhccccccCCccCCCcceeeecccccC
Q 029117           20 ASLCWDCDAKVHGANFLVANHSRTLLCHVCQS   51 (198)
Q Consensus        20 A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s   51 (198)
                      +..|..|+....-+  .+.+|-..++|+.|..
T Consensus         3 ~~~C~eC~~~f~dS--yL~~~F~~~VCD~CRD   32 (34)
T PF01286_consen    3 YPKCDECGKPFMDS--YLLNNFDLPVCDKCRD   32 (34)
T ss_dssp             -EE-TTT--EES-S--SCCCCTS-S--TTT-S
T ss_pred             CchHhHhCCHHHHH--HHHHhCCccccccccC
Confidence            45688888877744  4678888888888864


No 51 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=20.64  E-value=77  Score=32.59  Aligned_cols=50  Identities=22%  Similarity=0.553  Sum_probs=34.8

Q ss_pred             ceEEeccCc-cccCchhccccccCCccCCCcceeeecccccCCCCCcCCCCCCCCccccCcccccC
Q 029117           11 AKMFCESDQ-ASLCWDCDAKVHGANFLVANHSRTLLCHVCQSLTPWNGSGPKLGPTISVCNVCVGN   75 (198)
Q Consensus        11 A~vyC~aD~-A~LC~~CDa~VHsAN~La~rH~RvpLC~~C~s~~A~~~sG~C~~d~asLC~sCd~~   75 (198)
                      ..|.|+.+. ..=|..||...-     ..++.+.+.|..|......          ..-|..|-..
T Consensus       434 ~~l~C~~Cg~v~~Cp~Cd~~lt-----~H~~~~~L~CH~Cg~~~~~----------p~~Cp~Cgs~  484 (730)
T COG1198         434 PLLLCRDCGYIAECPNCDSPLT-----LHKATGQLRCHYCGYQEPI----------PQSCPECGSE  484 (730)
T ss_pred             ceeecccCCCcccCCCCCcceE-----EecCCCeeEeCCCCCCCCC----------CCCCCCCCCC
Confidence            467788774 667999987653     3367789999999975321          3457788655


No 52 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=20.49  E-value=37  Score=21.13  Aligned_cols=23  Identities=43%  Similarity=0.875  Sum_probs=15.6

Q ss_pred             CCCCCCCCCceEEeccCccccCc
Q 029117            2 KKCELCGSPAKMFCESDQASLCW   24 (198)
Q Consensus         2 ~~Cd~C~apA~vyC~aD~A~LC~   24 (198)
                      .+|.+|+.++..-|....+..|.
T Consensus         3 ~~C~vC~~~~kY~Cp~C~~~~CS   25 (30)
T PF04438_consen    3 KLCSVCGNPAKYRCPRCGARYCS   25 (30)
T ss_dssp             EEETSSSSEESEE-TTT--EESS
T ss_pred             CCCccCcCCCEEECCCcCCceeC
Confidence            36888888888888888777775


Done!