BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029143
         (198 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2FAF|A Chain A, The Structure Of Chicken Mitochondrial Pepck.
 pdb|2FAF|B Chain B, The Structure Of Chicken Mitochondrial Pepck.
 pdb|2FAH|A Chain A, The Structure Of Mitochondrial Pepck, Complex With Mn And
           Gdp
 pdb|2FAH|B Chain B, The Structure Of Mitochondrial Pepck, Complex With Mn And
           Gdp
 pdb|2FAH|C Chain C, The Structure Of Mitochondrial Pepck, Complex With Mn And
           Gdp
 pdb|2FAH|D Chain D, The Structure Of Mitochondrial Pepck, Complex With Mn And
           Gdp
 pdb|2QZY|A Chain A, The Structure Of Chicken Mitochondrial Pepck In Complex
           With Pep
 pdb|2QZY|B Chain B, The Structure Of Chicken Mitochondrial Pepck In Complex
           With Pep
          Length = 608

 Score = 27.7 bits (60), Expect = 4.6,   Method: Composition-based stats.
 Identities = 12/39 (30%), Positives = 23/39 (58%), Gaps = 1/39 (2%)

Query: 34  GTPIPLKGGVICKYPSDPS-VVLGYLSAAFLVASIVAGY 71
           G P+PL   ++  +P DPS V++ ++ +   + S  +GY
Sbjct: 183 GRPLPLTEPLVSSWPCDPSRVLVAHIPSERRIVSFGSGY 221


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.135    0.402 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,134,738
Number of Sequences: 62578
Number of extensions: 167646
Number of successful extensions: 229
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 229
Number of HSP's gapped (non-prelim): 1
length of query: 198
length of database: 14,973,337
effective HSP length: 94
effective length of query: 104
effective length of database: 9,091,005
effective search space: 945464520
effective search space used: 945464520
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)