Citrus Sinensis ID: 029152


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MEKRRHCCERKGEREERTLLYKLCFHRNSSYCQFNIVFLLVLIGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQQQVS
cccccccccccccccccccccccccccccHHHHHHccccEEEcccccccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEccccCEEEEEccHHHHHHHHHHHcccECccCEEEEEEcccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccc
****************RTLLYKLCFHRNSSYCQFNIVFLLVLIGG*********************IFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPA********GNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVY********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKRRHCCERKGEREERTLLYKLCFHRNSSYCQFNIVFLLVLIGGYASNGAPGQGPQSEGDSSNTTIFVGGLDPNVTDEDLRQPFSQYGEIASVKIPVGKGCGFVQFANRENAEEALHKLNGTVIGKQSVRLSWGRNPANKQFRADYGNQWSGAYYGGQVYDGYGYAIPPPNDPSMYAAAAAAYGAYPVYGSHQQQVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polyadenylate-binding protein RBP47C' Heterogeneous nuclear ribonucleoprotein (hnRNP)-protein binding the poly(A) tail of mRNA and probably involved in some steps of pre-mRNA maturation.probableQ9SX80

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GHP, chain A
Confidence level:very confident
Coverage over the Query: 63-138
View the alignment between query and template
View the model in PyMOL
Template: 3U1L, chain A
Confidence level:very confident
Coverage over the Query: 3-136
View the alignment between query and template
View the model in PyMOL