Citrus Sinensis ID: 029153

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MAASSSTAATLSWSSSSFFQTFGNTVNESVKLPDKRSALLVLAQKKAKKTRKIILKEDVAELGKKGQLLDVKAGFYRNYLHPMGKAQIVTPLLLKEMKMEEERIEAEKKRVKEEAQQLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQLKLHPEVTARIRLNVFAN
cccccccccccccccccccccccccccccccccccccEEEEEEcccccccEEEEEEcccccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEccccccEEEcccHHHHHHHHHHHccccccccccccccccccEEEEEEEEEcccEEEEEEEEEEEc
***********SWSSSSFF****************RSALLVLAQKKAKKTRKIILKEDVAELGKKGQLLDVKAGFYRNYLHPMGKAQIVTPLLLK*********************QLALIFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQLKLHPEVTARIRLNVFAN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAASSSTAATLSWSSSSFFQTFGNTVNESVKLPDKRSALLVLAQKKAKKTRKIILKEDVAELGKKGQLLDVKAGFYRNYLHPMGKAQIVTPLLxxxxxxxxxxxxxxxxxxxxxxxxxxxxFETVGAFKVKRKGGKGKQIFGSVTAQDVVDIIKAQLQRDVDKKIVDLPEIRETGEYIAQLKLHPEVTARIRLNVFAN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
50S ribosomal protein L9, chloroplastic Binds to the 23S rRNA.confidentP25864
50S ribosomal protein L9, chloroplastic Binds to the 23S rRNA.probableP11894
50S ribosomal protein L9, chloroplastic Binds to the 23S rRNA.probableQ6JJ61

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain J
Confidence level:very confident
Coverage over the Query: 57-198
View the alignment between query and template
View the model in PyMOL