Citrus Sinensis ID: 029160


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MTSCIKLEVHTDDRTPHKWIVALGEDVFRRFLSQGNPAVHKAFGDGSLFSPLLFGKFFDPSDAFPLWEFESDVLLSHLQSTGQSSVDWLQTDQAYVLKAELPGVGKNQVQVSVENGKIVEISGQWKEQRDPRAKDWRSGHWWEHGFVRRLELPEDADWRKTEAYLSNDVFLEIRIPKNPSTCDISHGNGAATKNSEAM
ccccCEEEEEccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHccccccccccEEEEccccEEEEEEccccccccEEEEEEcccEEEEEEEEEEccccccccEEEEEECccCEEEEEEccccccccccEEEEccccEEEEEcccccccccccccccccccccccc
****IKLEVHTDDRTPHKWIVALGEDVFRRFLSQGNPAVHKAFGDGSLFSPLLFGKFFDPSDAFPLWEFESDVLLSHLQSTGQSSVDWLQTDQAYVLKAELPGVGKNQVQVSVENGKIVEISGQ************RSGHWWEHGFVRRLELPEDADWRKTEAYLSNDVFLEIRIP**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSCIKLEVHTDDRTPHKWIVALGEDVFRRFLSQGNPAVHKAFGDGSLFSPLLFGKFFDPSDAFPLWEFESDVLLSHLQSTGQSSVDWLQTDQAYVLKAELPGVGKNQVQVSVENGKIVEISGQWKEQRDPRAKDWRSGHWWEHGFVRRLELPEDADWRKTEAYLSNDVFLEIRIPKNPSTCDISHGNGAATKNSEAM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
21.7 kDa class VI heat shock protein probableQ9FIT9
22.3 kDa class VI heat shock protein probableQ6AUW3

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GME, chain A
Confidence level:very confident
Coverage over the Query: 80-182
View the alignment between query and template
View the model in PyMOL