BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029179
         (197 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P38179|ALG3_YEAST Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
           OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
           GN=ALG3 PE=1 SV=1
          Length = 458

 Score = 31.6 bits (70), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 3/58 (5%)

Query: 50  KGKRGLQARQFQRPPPPSLPKIEDDGNPRFVIFIRMANVYLWYPLSIITGGTTAKIMV 107
           +G++ LQ +QF RPP      ++D    R+VIF   AN+ +  PL I+      KI++
Sbjct: 8   QGEKSLQRKQFVRPPLDLWQDLKD--GVRYVIFDCRANLIV-MPLLILFESMLCKIII 62


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.325    0.139    0.418 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 68,572,031
Number of Sequences: 539616
Number of extensions: 2598182
Number of successful extensions: 9313
Number of sequences better than 100.0: 13
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 9300
Number of HSP's gapped (non-prelim): 16
length of query: 197
length of database: 191,569,459
effective HSP length: 111
effective length of query: 86
effective length of database: 131,672,083
effective search space: 11323799138
effective search space used: 11323799138
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 58 (26.9 bits)