BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029183
         (197 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2LJO|A Chain A, 3d Solution Structure Of Lipid Transfer Protein Lc-Ltp2
          Length = 93

 Score = 29.6 bits (65), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 6/61 (9%)

Query: 32 LSTCLPYVGGDAKAPTPDCCSGLKQVLKN-----DKKCLCVIIRDRNDPELGLNINVTLA 86
          LS CL Y+ G    P+P CC G+K++L       D++  C  ++        LN N   A
Sbjct: 11 LSPCLTYLTG-GPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAA 69

Query: 87 L 87
          L
Sbjct: 70 L 70


>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
          Lipid-Transfer Protein Complexes With Capric Acid
          Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
          Lipid-Transfer Protein Complexes With Lauric Acid
          Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
          Lipid-Transfer Protein Complexes With Myristic Acid
          Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
          Lipid-Transfer Protein Complexes With Palmitoleic Acid
          Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
          Lipid-Transfer Protein Complexes With Stearic Acid
          Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
          Lipid-Transfer Protein Complexes With Oleic Acid
          Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
          Lipid-Transfer Protein Complexes With Alpha-Linolenic
          Acid Revealed By High-Resolution X-Ray Crystallography
 pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
          Lipid-Transfer Protein Complexes With Ricinoleic Acid
          Revealed By High-Resolution X-Ray Crystallography
 pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15
          Structures
 pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
 pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With
          Palmitate
          Length = 93

 Score = 28.5 bits (62), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 31/75 (41%), Gaps = 7/75 (9%)

Query: 24 ECTNQLVGLSTCLPYVGGDAKAPTPDCCSGLKQV-----LKNDKKCLCVIIRDRNDPELG 78
           C      ++ C+ Y  G    P+  CCSG++ +        D++  C  +++      G
Sbjct: 3  SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 62

Query: 79 LNINVTLALGLPSVC 93
          LN     A  +PS C
Sbjct: 63 LNAG--NAASIPSKC 75


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.137    0.423 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,585,264
Number of Sequences: 62578
Number of extensions: 214162
Number of successful extensions: 285
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 284
Number of HSP's gapped (non-prelim): 3
length of query: 197
length of database: 14,973,337
effective HSP length: 94
effective length of query: 103
effective length of database: 9,091,005
effective search space: 936373515
effective search space used: 936373515
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)