BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 029183
(197 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2LJO|A Chain A, 3d Solution Structure Of Lipid Transfer Protein Lc-Ltp2
Length = 93
Score = 29.6 bits (65), Expect = 1.1, Method: Compositional matrix adjust.
Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 6/61 (9%)
Query: 32 LSTCLPYVGGDAKAPTPDCCSGLKQVLKN-----DKKCLCVIIRDRNDPELGLNINVTLA 86
LS CL Y+ G P+P CC G+K++L D++ C ++ LN N A
Sbjct: 11 LSPCLTYLTG-GPGPSPQCCGGVKKLLAAANTTPDRQAACNCLKSAAGSITKLNTNNAAA 69
Query: 87 L 87
L
Sbjct: 70 L 70
>pdb|1FK0|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Capric Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK1|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Lauric Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK2|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Myristic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK3|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Palmitoleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK4|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Stearic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK5|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Oleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1FK6|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Alpha-Linolenic
Acid Revealed By High-Resolution X-Ray Crystallography
pdb|1FK7|A Chain A, Structural Basis Of Non-Specific Lipid Binding In Maize
Lipid-Transfer Protein Complexes With Ricinoleic Acid
Revealed By High-Resolution X-Ray Crystallography
pdb|1AFH|A Chain A, Lipid Transfer Protein From Maize Seedlings, Nmr, 15
Structures
pdb|1MZL|A Chain A, Maize Nonspecific Lipid Transfer Protein
pdb|1MZM|A Chain A, Maize Nonspecific Lipid Transfer Protein Complexed With
Palmitate
Length = 93
Score = 28.5 bits (62), Expect = 2.2, Method: Compositional matrix adjust.
Identities = 18/75 (24%), Positives = 31/75 (41%), Gaps = 7/75 (9%)
Query: 24 ECTNQLVGLSTCLPYVGGDAKAPTPDCCSGLKQV-----LKNDKKCLCVIIRDRNDPELG 78
C ++ C+ Y G P+ CCSG++ + D++ C +++ G
Sbjct: 3 SCGQVASAIAPCISYARGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSG 62
Query: 79 LNINVTLALGLPSVC 93
LN A +PS C
Sbjct: 63 LNAG--NAASIPSKC 75
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.137 0.423
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,585,264
Number of Sequences: 62578
Number of extensions: 214162
Number of successful extensions: 285
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 284
Number of HSP's gapped (non-prelim): 3
length of query: 197
length of database: 14,973,337
effective HSP length: 94
effective length of query: 103
effective length of database: 9,091,005
effective search space: 936373515
effective search space used: 936373515
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 49 (23.5 bits)