Query         029187
Match_columns 197
No_of_seqs    98 out of 100
Neff          3.4 
Searched_HMMs 46136
Date          Fri Mar 29 08:53:54 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/029187.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/029187hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03138 Protein TOC75; Provis  95.1   0.058 1.3E-06   54.8   6.9   19    2-20      5-23  (796)
  2 COG4907 Predicted membrane pro  89.0    0.34 7.3E-06   47.6   3.0   10   30-39    546-555 (595)
  3 TIGR02877 spore_yhbH sporulati  88.0     1.6 3.4E-05   41.3   6.6   31  103-138   100-130 (371)
  4 PRK05325 hypothetical protein;  87.9     1.5 3.2E-05   41.7   6.4   15  119-133   100-114 (401)
  5 PF04285 DUF444:  Protein of un  86.3     1.9 4.1E-05   41.2   6.2   26  103-132   104-129 (421)
  6 PLN03138 Protein TOC75; Provis  80.7     1.5 3.2E-05   45.0   3.2    7  155-161   257-263 (796)
  7 PHA00370 III attachment protei  80.4     2.8   6E-05   38.5   4.6   19  153-172   213-231 (297)
  8 PF02979 NHase_alpha:  Nitrile   78.4     2.1 4.6E-05   37.2   3.0   45  144-188    16-66  (188)
  9 PF04285 DUF444:  Protein of un  73.0     4.7  0.0001   38.6   4.1    8  101-108   106-113 (421)
 10 KOG3074 Transcriptional regula  62.4     7.2 0.00016   35.5   2.8   20  138-157    91-110 (263)
 11 PF08671 SinI:  Anti-repressor   62.3     8.2 0.00018   24.4   2.3   21  141-162     9-29  (30)
 12 TIGR03793 TOMM_pelo TOMM prope  60.4     5.2 0.00011   29.9   1.4   21  175-195    16-37  (77)
 13 PF07631 PSD4:  Protein of unkn  53.0      21 0.00046   28.5   3.8   34  136-188    17-51  (128)
 14 PF02084 Bindin:  Bindin;  Inte  49.6      46   0.001   30.1   5.7   25  124-148   107-131 (238)
 15 PF02957 TT_ORF2:  TT viral ORF  48.0      24 0.00053   27.4   3.4    8  123-130   111-118 (122)
 16 TIGR01323 nitrile_alph nitrile  46.7      20 0.00044   31.2   3.0   47  144-190    10-62  (185)
 17 PF14407 Frankia_peptide:  Ribo  46.3      11 0.00023   27.6   1.1   13  176-188    13-25  (61)
 18 TIGR03795 chp_BMA0021 conserve  43.3      19 0.00041   29.1   2.1   20  168-187    18-39  (114)
 19 COG2718 Uncharacterized conser  42.8      41  0.0009   32.6   4.6   24  114-138   111-134 (423)
 20 PF15451 DUF4632:  Domain of un  41.7      36 0.00078   25.4   3.2   20  123-142    39-58  (71)
 21 PLN02960 alpha-amylase          39.8      43 0.00093   35.3   4.6   46    1-52      1-46  (897)
 22 PF15059 Speriolin_C:  Sperioli  39.0      16 0.00035   30.8   1.2   65  133-197    28-117 (146)
 23 PLN03244 alpha-amylase; Provis  37.8      37  0.0008   35.7   3.7   46    1-52      4-49  (872)
 24 PF12244 DUF3606:  Protein of u  37.7      58  0.0013   22.7   3.7   34  127-160    23-56  (57)
 25 PF06524 NOA36:  NOA36 protein;  37.0      45 0.00097   31.1   3.8    6   79-84    245-250 (314)
 26 COG3737 Uncharacterized conser  33.0      25 0.00055   29.0   1.4   36  122-157    59-104 (127)
 27 KOG1456 Heterogeneous nuclear   29.5      53  0.0011   32.1   3.1   11  139-149    46-56  (494)
 28 PRK05325 hypothetical protein;  28.6      67  0.0015   30.8   3.6   17  121-137   147-163 (401)
 29 COG2718 Uncharacterized conser  27.4      85  0.0019   30.5   4.1   16   99-114   100-115 (423)
 30 KOG0105 Alternative splicing f  26.0      76  0.0016   28.5   3.2   10  122-131   131-140 (241)
 31 COG4174 ABC-type uncharacteriz  25.9 1.3E+02  0.0029   28.4   4.9   19  146-164    90-108 (364)
 32 TIGR02877 spore_yhbH sporulati  25.7      91   0.002   29.8   3.9   14  123-136   161-174 (371)
 33 PF04360 Serglycin:  Serglycin   24.6      51  0.0011   27.9   1.9   20   19-38      5-24  (150)
 34 COG3423 Nlp Predicted transcri  22.0      66  0.0014   24.9   1.8   46  138-185    10-55  (82)
 35 TIGR00625 tfb2 Transcription f  21.8 1.5E+02  0.0033   28.9   4.7   66  124-191   312-398 (448)
 36 PRK08558 adenine phosphoribosy  21.3 2.6E+02  0.0057   24.3   5.7   38  123-165    13-50  (238)
 37 PF10415 FumaraseC_C:  Fumarase  20.6 1.2E+02  0.0026   21.0   2.8   36  124-162    15-50  (55)
 38 smart00845 GatB_Yqey GatB doma  20.5 2.2E+02  0.0048   22.6   4.7   68  123-196    61-146 (147)
 39 PF05225 HTH_psq:  helix-turn-h  20.1 1.1E+02  0.0024   20.1   2.5   22  141-162    19-40  (45)

No 1  
>PLN03138 Protein TOC75; Provisional
Probab=95.08  E-value=0.058  Score=54.80  Aligned_cols=19  Identities=26%  Similarity=0.183  Sum_probs=13.6

Q ss_pred             CcccccccCCCCCCCCCCC
Q 029187            2 SACSSTFRLPNLPNISPQN   20 (197)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~   20 (197)
                      ++|.+.++-+.++...+|+
T Consensus         5 ~~~~~~~~~~~~~~~~~~~   23 (796)
T PLN03138          5 STMVSAAASTSLSSSRPQL   23 (796)
T ss_pred             cccceeccCCCccCCCccc
Confidence            5777777777777766664


No 2  
>COG4907 Predicted membrane protein [Function unknown]
Probab=88.96  E-value=0.34  Score=47.58  Aligned_cols=10  Identities=0%  Similarity=-0.104  Sum_probs=5.7

Q ss_pred             eeeecccccC
Q 029187           30 FLSLRHSTAT   39 (197)
Q Consensus        30 ~~~l~hs~~~   39 (197)
                      |...||+.+|
T Consensus       546 ~~i~h~nysr  555 (595)
T COG4907         546 SPIFHNNYSR  555 (595)
T ss_pred             eeEEecchhh
Confidence            4445666664


No 3  
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=87.98  E-value=1.6  Score=41.25  Aligned_cols=31  Identities=35%  Similarity=0.468  Sum_probs=18.3

Q ss_pred             CCCCCCCCCCccccccCcccHHHHHHHHHHhCCCCc
Q 029187          103 GGGDGEGNDGEEKEFGPILKFEEVMKEIELKGVGLP  138 (197)
Q Consensus       103 g~g~g~~dd~~e~efG~il~~eeVLaEa~Rrg~SLP  138 (197)
                      |.|+|+++|+-+    --++.||.+.....-+ .||
T Consensus       100 gag~geGed~fe----~e~s~eE~~~~lfEdL-eLP  130 (371)
T TIGR02877       100 GAGDQEGEDYYE----TEVTLEELFELLFEDL-ELP  130 (371)
T ss_pred             CCCCCCCcceEE----EEecHHHHHHHHHhhc-cCC
Confidence            344455555433    4478888888777654 355


No 4  
>PRK05325 hypothetical protein; Provisional
Probab=87.87  E-value=1.5  Score=41.71  Aligned_cols=15  Identities=13%  Similarity=0.102  Sum_probs=10.0

Q ss_pred             CcccHHHHHHHHHHh
Q 029187          119 PILKFEEVMKEIELK  133 (197)
Q Consensus       119 ~il~~eeVLaEa~Rr  133 (197)
                      --++.||.+......
T Consensus       100 ~els~eE~~~~lfEd  114 (401)
T PRK05325        100 FEISLEELLDLLFED  114 (401)
T ss_pred             EEecHHHHHHHHHhh
Confidence            446777777776654


No 5  
>PF04285 DUF444:  Protein of unknown function (DUF444);  InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches [].
Probab=86.28  E-value=1.9  Score=41.22  Aligned_cols=26  Identities=42%  Similarity=0.500  Sum_probs=13.5

Q ss_pred             CCCCCCCCCCccccccCcccHHHHHHHHHH
Q 029187          103 GGGDGEGNDGEEKEFGPILKFEEVMKEIEL  132 (197)
Q Consensus       103 g~g~g~~dd~~e~efG~il~~eeVLaEa~R  132 (197)
                      |.|+++|+|+-+    --++.||++.....
T Consensus       104 gag~geGeD~fe----~els~eE~~~llfE  129 (421)
T PF04285_consen  104 GAGDGEGEDDFE----FELSREEFLDLLFE  129 (421)
T ss_pred             CCCCCCCCCeEE----EEEEHHHHHHHhHH
Confidence            445555555433    34566666655554


No 6  
>PLN03138 Protein TOC75; Provisional
Probab=80.66  E-value=1.5  Score=44.96  Aligned_cols=7  Identities=14%  Similarity=0.311  Sum_probs=2.6

Q ss_pred             HHHHHhh
Q 029187          155 LLRYLDL  161 (197)
Q Consensus       155 L~Ryl~L  161 (197)
                      |..+++.
T Consensus       257 l~~~~~~  263 (796)
T PLN03138        257 KMEYYRS  263 (796)
T ss_pred             HHHHhhc
Confidence            3333333


No 7  
>PHA00370 III attachment protein
Probab=80.42  E-value=2.8  Score=38.52  Aligned_cols=19  Identities=21%  Similarity=0.046  Sum_probs=9.3

Q ss_pred             HHHHHHHhhhcCcchHHHHH
Q 029187          153 MFLLRYLDLQGSVWPLGFLM  172 (197)
Q Consensus       153 a~L~Ryl~L~asp~~l~~L~  172 (197)
                      ++|...=+=+.+|| +.+|.
T Consensus       213 s~md~lg~g~gS~~-~~~l~  231 (297)
T PHA00370        213 SEMDQLGEGDGSPL-ESFLN  231 (297)
T ss_pred             hhhhhhcccCCcHH-HHhhc
Confidence            44443334455566 45554


No 8  
>PF02979 NHase_alpha:  Nitrile hydratase, alpha chain;  InterPro: IPR004232 Nitrile hydratases (4.2.1.84 from EC) are bacterial enzymes that catalyse the hydration of nitrile compounds to the corresponding amides. They are used as biocatalysts in acrylamide production, one of the few commercial scale bioprocesses, as well as in environmental remediation for the removal of nitriles from waste streams. Nitrile hydratases are composed of two subunits, alpha and beta, and are normally active as a tetramer, alpha(2)beta(2). Nitrile hydratases contain either a non-haem iron or a non-corrinoid cobalt centre, both types sharing a highly conserved peptide sequence in the alpha subunit (CXLCSC) that provides all the residues involved in coordinating the metal ion. Each type of nitrile hydratase specifically incorporated its metal with the help of activator proteins encoded by flanking regions of the nitrile hydratase genes that are necessary for metal insertion. The Fe-containing enzyme is photo-regulated: in the dark the enzyme is inactivated due to the association of nitric oxide (NO) to the iron, while in the light the enzyme is active by photo-dissociation of NO. The NO is held in place by a claw setting formed through specific oxygen atoms in two modified cysteines and a serine residue in the active site [, ]. The cobalt-containing enzyme is unaffected by NO, but was shown to undergo a similar effect with carbon monoxide [, ]. Fe- and cobalt-containing enzymes also display different inhibition patterns with nitrophenols. Thiocyanate hydrolase (SCNase) is a cobalt-containing metalloenzyme with a cysteine-sulphinic acid ligand that hydrolyses thiocyanate to carbonyl sulphide and ammonia []. The two enzymes, nitrile hydratase and SCNase, are homologous over regions corresponding to almost the entire coding regions of the genes: the beta and alpha subunits of thiocyanate hydrolase were homologous to the amino- and carboxyl-terminal halves of the beta subunit of nitrile hydratase, and the gamma subunit of thiocyanate hydrolase was homologous to the alpha subunit of nitrile hydratase [].  This entry represents the structural domain of the alpha subunit of both iron- and cobalt-containing nitrile hydratases; the alpha subunit is a duplication of two structural repeats, each consisting of 4 layers, alpha/beta/beta/alpha []. This structure is also found in the related protein, the gamma subunit of thiocyanate hydrolase (SCNase).; GO: 0003824 catalytic activity, 0046914 transition metal ion binding, 0006807 nitrogen compound metabolic process; PDB: 2DPP_A 3HHT_A 1V29_A 2ZZD_I 2DXC_F 2DXB_F 2DD5_C 2DD4_C 2ZPH_A 2CYZ_A ....
Probab=78.36  E-value=2.1  Score=37.19  Aligned_cols=45  Identities=20%  Similarity=0.124  Sum_probs=30.4

Q ss_pred             HHHhcCcCHHHHHHHHhhhcCc---c-hHHHHHHhh--hHHHHhhhcCchh
Q 029187          144 AAKTVGIRKMFLLRYLDLQGSV---W-PLGFLMRYC--FMLRDRMLADPSF  188 (197)
Q Consensus       144 Aae~GgIrsa~L~Ryl~L~asp---~-~l~~L~rs~--p~fR~RLLADP~F  188 (197)
                      .++.|.|+++.+.++++...+-   - -.+.+-|.|  |+||.||||||.=
T Consensus        16 l~ekg~~~~~~~~~~~~~~~~~~~P~~GarvVArAW~Dp~FK~rLLaD~~a   66 (188)
T PF02979_consen   16 LIEKGLITPAEVDRIIETYESRVGPRNGARVVARAWTDPAFKARLLADPTA   66 (188)
T ss_dssp             HHHTTSS-HHHHHHHHHHHHHTSSHHHHHHHHHHHHH-HHHHHHHHHSHHH
T ss_pred             HHHcCCCCHHHHHHHHHHHHhccCccccceeehhhhCCHHHHHHHHHCHHH
Confidence            3678889999888888765543   1 123334444  5999999999974


No 9  
>PF04285 DUF444:  Protein of unknown function (DUF444);  InterPro: IPR006698 This entry is represented by Thermus phage phiYS40, Orf56. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches [].
Probab=72.98  E-value=4.7  Score=38.59  Aligned_cols=8  Identities=38%  Similarity=1.024  Sum_probs=3.6

Q ss_pred             CCCCCCCC
Q 029187          101 GGGGGDGE  108 (197)
Q Consensus       101 Ggg~g~g~  108 (197)
                      |.|.|.++
T Consensus       106 g~geGeD~  113 (421)
T PF04285_consen  106 GDGEGEDD  113 (421)
T ss_pred             CCCCCCCe
Confidence            44444444


No 10 
>KOG3074 consensus Transcriptional regulator of the PUR family, single-stranded-DNA-binding [Transcription]
Probab=62.42  E-value=7.2  Score=35.47  Aligned_cols=20  Identities=15%  Similarity=0.305  Sum_probs=12.1

Q ss_pred             cHHHHHHHHhcCcCHHHHHH
Q 029187          138 PDDMMEAAKTVGIRKMFLLR  157 (197)
Q Consensus       138 PaDL~eAae~GgIrsa~L~R  157 (197)
                      |.++++..+.+.+-++.|++
T Consensus        91 ~~~~~~~~ee~~lkSe~L~~  110 (263)
T KOG3074|consen   91 PPELAAPSEEHELKSEELQR  110 (263)
T ss_pred             CcccccchhhhhHHHHHHhh
Confidence            45666666666666666654


No 11 
>PF08671 SinI:  Anti-repressor SinI;  InterPro: IPR010981 The SinR repressor is part of a group of Sin (sporulation inhibition) proteins in Bacillus subtilis that regulate the commitment to sporulation in response to extreme adversity []. SinR is a tetrameric repressor protein that binds to the promoters of genes essential for entry into sporulation and prevents their transcription. This repression is overcome through the activity of SinI, which disrupts the SinR tetramer through the formation of a SinI-SinR heterodimer, thereby allowing sporulation to proceed. The SinR structure consists of two domains: a dimerisation domain stabilised by a hydrophobic core, and a DNA-binding domain that is identical to domains of the bacteriophage 434 CI and Cro proteins that regulate prophage induction. The dimerisation domain is a four-helical bundle formed from two helices from the C-terminal residues of SinR and two helices from the central residues of SinI. These regions in SinR and SinI are similar in both structure and sequence. The interaction of SinR monomers to form tetramers is weaker than between SinR and SinI, since SinI can effectively disrupt SinR tetramers. This entry represents the dimerisation domain in both SinI and SinR proteins.; GO: 0005488 binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1B0N_A 2YAL_A.
Probab=62.33  E-value=8.2  Score=24.44  Aligned_cols=21  Identities=19%  Similarity=0.343  Sum_probs=14.4

Q ss_pred             HHHHHHhcCcCHHHHHHHHhhh
Q 029187          141 MMEAAKTVGIRKMFLLRYLDLQ  162 (197)
Q Consensus       141 L~eAae~GgIrsa~L~Ryl~L~  162 (197)
                      |.+|.++| ++.+.+..||+.+
T Consensus         9 i~eA~~~G-ls~eeir~FL~~~   29 (30)
T PF08671_consen    9 IKEAKESG-LSKEEIREFLEFN   29 (30)
T ss_dssp             HHHHHHTT---HHHHHHHHHHH
T ss_pred             HHHHHHcC-CCHHHHHHHHHhC
Confidence            44566655 9999999999875


No 12 
>TIGR03793 TOMM_pelo TOMM propeptide domain. This model represents a domain that is conserved among a large number of putative thiazole/oxazole-modified microcins (TOMM). Oddly, most of this seqence region appears homologous to nitrile hydratase subunits. This family is expanded especially in Pelotomaculum thermopropionicum SI.
Probab=60.36  E-value=5.2  Score=29.86  Aligned_cols=21  Identities=19%  Similarity=0.341  Sum_probs=15.3

Q ss_pred             hhHHHHhhhcCch-hhhhhhhc
Q 029187          175 CFMLRDRMLADPS-FLFKVGTE  195 (197)
Q Consensus       175 ~p~fR~RLLADP~-FL~Kl~~E  195 (197)
                      =|.||.|||+||. =|.+++++
T Consensus        16 Dp~Fr~~Ll~DPraaL~e~G~~   37 (77)
T TIGR03793        16 DEAFKQALLTNPKEALEREGVQ   37 (77)
T ss_pred             CHHHHHHHHHCHHHHHHHhCCC
Confidence            3699999999998 44445543


No 13 
>PF07631 PSD4:  Protein of unknown function (DUF1592);  InterPro: IPR013042  A region of similarity shared by several Rhodopirellula baltica cytochrome-like proteins that are predicted to be secreted. These proteins also contain IPR011478 from INTERPRO, IPR013036 from INTERPRO, IPR013039 from INTERPRO and IPR013043 from INTERPRO.
Probab=53.04  E-value=21  Score=28.53  Aligned_cols=34  Identities=32%  Similarity=0.486  Sum_probs=22.3

Q ss_pred             CCc-HHHHHHHHhcCcCHHHHHHHHhhhcCcchHHHHHHhhhHHHHhhhcCchh
Q 029187          136 GLP-DDMMEAAKTVGIRKMFLLRYLDLQGSVWPLGFLMRYCFMLRDRMLADPSF  188 (197)
Q Consensus       136 SLP-aDL~eAae~GgIrsa~L~Ryl~L~asp~~l~~L~rs~p~fR~RLLADP~F  188 (197)
                      |.| +.|.+|++.|.+++...                .+   .-.+|||+||.+
T Consensus        17 s~PD~~L~~aA~~g~L~~~~~----------------l~---~q~~RML~dpr~   51 (128)
T PF07631_consen   17 SPPDAELLDAAAAGELRTPEQ----------------LR---AQAERMLADPRA   51 (128)
T ss_pred             CCCCHHHHHHHHhCCCCCHHH----------------HH---HHHHHHHcCccH
Confidence            456 67888888888853221                11   456778888875


No 14 
>PF02084 Bindin:  Bindin;  InterPro: IPR000775 Bindin, the major protein component of the acrosome granule of sea urchin sperm, mediates species-specific adhesion of sperm to the egg surface during fertilisation [, ]. The protein coats the acrosomal process after externalisation by the acrosome reaction; it binds to sulphated, fucose-containing polysaccharides on the vitelline-layer receptor proteoglycans that cover the egg plasma membrane. Bindins from different genera show high levels of sequence similarity in both the mature bindin domain and in the probindin precursor region. The most highly conserved region is a 42-residue segment in the central portion of the mature bindin protein. This domain may be responsible for conserved functions of bindin, while the more highly divergent flanking regions may be responsible for its species-specific properties [].; GO: 0007342 fusion of sperm to egg plasma membrane
Probab=49.63  E-value=46  Score=30.09  Aligned_cols=25  Identities=16%  Similarity=0.256  Sum_probs=19.2

Q ss_pred             HHHHHHHHHhCCCCcHHHHHHHHhc
Q 029187          124 EEVMKEIELKGVGLPDDMMEAAKTV  148 (197)
Q Consensus       124 eeVLaEa~Rrg~SLPaDL~eAae~G  148 (197)
                      |.+.+-+.+|..+||-|+-.-++.|
T Consensus       107 ~~ikavLgaTKiDLPVDINDPYDlG  131 (238)
T PF02084_consen  107 EDIKAVLGATKIDLPVDINDPYDLG  131 (238)
T ss_pred             HHHHHHhcccccccccccCChhhHH
Confidence            5666667789999999987766665


No 15 
>PF02957 TT_ORF2:  TT viral ORF2;  InterPro: IPR004118 This entry represents the Gyroviral VP2 protein and TT viral ORF2.  Torque teno virus (TTV) is a nonenveloped and single-stranded DNA virus that was initially isolated from a Japanese patient with hepatitis of unknown aetiology, and which has since been found to infect both healthy and diseased individuals []. Numerous prevalence studies have raised questions about its role in unexplained hepatitis. ORF2 is a 150 residue protein of unknown function.  Gyroviruses are small circular single stranded viruses, such as the Chicken anaemia virus. The VP2 protein contains a set of conserved cysteine and histidine residues suggesting a zinc binding domain. VP2 may act as a scaffold protein in virion assembly and may also play a role in intracellular signaling during viral replication.
Probab=48.04  E-value=24  Score=27.36  Aligned_cols=8  Identities=13%  Similarity=0.439  Sum_probs=3.8

Q ss_pred             HHHHHHHH
Q 029187          123 FEEVMKEI  130 (197)
Q Consensus       123 ~eeVLaEa  130 (197)
                      +|++++++
T Consensus       111 ld~L~aa~  118 (122)
T PF02957_consen  111 LDELFAAA  118 (122)
T ss_pred             HHHHhhhh
Confidence            44555443


No 16 
>TIGR01323 nitrile_alph nitrile hydratase, alpha subunit. This model describes both iron- and cobalt-containing nitrile hydratase alpha chains. It excludes the thiocyanate hydrolase gamma subunit of Thiobacillus thioparus, a sequence that appears to have evolved from within the family of nitrile hydratase alpha subunits but which differs by several indels and a more rapid accumulation of point mutations.
Probab=46.69  E-value=20  Score=31.21  Aligned_cols=47  Identities=11%  Similarity=-0.082  Sum_probs=30.2

Q ss_pred             HHHhcCcCHHHHHHHHhhhcC---cc-hHHHHHHhh--hHHHHhhhcCchhhh
Q 029187          144 AAKTVGIRKMFLLRYLDLQGS---VW-PLGFLMRYC--FMLRDRMLADPSFLF  190 (197)
Q Consensus       144 Aae~GgIrsa~L~Ryl~L~as---p~-~l~~L~rs~--p~fR~RLLADP~FL~  190 (197)
                      .++.|.|..+.+.+.++.-.+   |. =.+.+-|.|  |.||.|||+|..=-.
T Consensus        10 l~eKGli~~~~id~~i~~~~~~~gP~nGA~vVArAW~Dp~fk~~Ll~d~~aa~   62 (185)
T TIGR01323        10 LKSKGLIPEGAVDQLTSLYENEWGPENGAKVVAKAWVDPEFRALLLKDATAAC   62 (185)
T ss_pred             HHHcCCCCHHHHHHHHHHHHhccCCcchhhhhhHHhcCHHHHHHHHhChHHHH
Confidence            356788888888777765444   21 122333333  699999999987433


No 17 
>PF14407 Frankia_peptide:  Ribosomally synthesized peptide prototyped by Frankia Franean1_4349.
Probab=46.33  E-value=11  Score=27.64  Aligned_cols=13  Identities=38%  Similarity=0.572  Sum_probs=11.3

Q ss_pred             hHHHHhhhcCchh
Q 029187          176 FMLRDRMLADPSF  188 (197)
Q Consensus       176 p~fR~RLLADP~F  188 (197)
                      ++||.|+||||.-
T Consensus        13 ~~FRqqllad~~~   25 (61)
T PF14407_consen   13 EAFRQQLLADPEE   25 (61)
T ss_pred             HHHHHHHhcCHHH
Confidence            5899999999974


No 18 
>TIGR03795 chp_BMA0021 conserved hypothetical protein, BMA_0021 family. Members of this protein family are found sparsely, mostly in members of the genus Burkholderia. Members often occur as tandem homologous genes, such as BMA_0021 and BMA_0022 in Burkholderia mallei ATCC 23344. The genes regularly are encoded near the so-called docking protein of TOMM (thiazole/oxazole-modified microcins) biosynthetic clusters, suggesting a role in bacteriocin biosynthesis. The function is unknown.
Probab=43.35  E-value=19  Score=29.06  Aligned_cols=20  Identities=30%  Similarity=0.428  Sum_probs=15.5

Q ss_pred             HHHHHHhhh--HHHHhhhcCch
Q 029187          168 LGFLMRYCF--MLRDRMLADPS  187 (197)
Q Consensus       168 l~~L~rs~p--~fR~RLLADP~  187 (197)
                      +|.+-+++.  .||+|||+||.
T Consensus        18 lraIA~AW~DpaFr~eLl~DPk   39 (114)
T TIGR03795        18 LRAIALAWHSPEFKDELLADPV   39 (114)
T ss_pred             HHHHHHHhCCHHHHHHHHHCHH
Confidence            455555554  99999999997


No 19 
>COG2718 Uncharacterized conserved protein [Function unknown]
Probab=42.80  E-value=41  Score=32.60  Aligned_cols=24  Identities=33%  Similarity=0.257  Sum_probs=14.5

Q ss_pred             cccccCcccHHHHHHHHHHhCCCCc
Q 029187          114 EKEFGPILKFEEVMKEIELKGVGLP  138 (197)
Q Consensus       114 e~efG~il~~eeVLaEa~Rrg~SLP  138 (197)
                      |++|-.-++.+||+....+-++ ||
T Consensus       111 ED~F~~~is~~e~~dllFedL~-LP  134 (423)
T COG2718         111 EDEFVFQISREEVLDLLFEDLE-LP  134 (423)
T ss_pred             cchhheeeehhHHHHHHHHHhh-Cc
Confidence            3444466777777777766543 55


No 20 
>PF15451 DUF4632:  Domain of unknown function (DUF4632)
Probab=41.67  E-value=36  Score=25.43  Aligned_cols=20  Identities=15%  Similarity=0.335  Sum_probs=15.4

Q ss_pred             HHHHHHHHHHhCCCCcHHHH
Q 029187          123 FEEVMKEIELKGVGLPDDMM  142 (197)
Q Consensus       123 ~eeVLaEa~Rrg~SLPaDL~  142 (197)
                      .+.||+-|.|-.-.||..++
T Consensus        39 wdrvl~parrwrrplpsnvl   58 (71)
T PF15451_consen   39 WDRVLAPARRWRRPLPSNVL   58 (71)
T ss_pred             HHHHHhHHHHhccCCCccce
Confidence            48899888888888886543


No 21 
>PLN02960 alpha-amylase
Probab=39.85  E-value=43  Score=35.28  Aligned_cols=46  Identities=20%  Similarity=0.174  Sum_probs=27.2

Q ss_pred             CCcccccccCCCCCCCCCCCCcccccceeeeeecccccCCcceeeeeeccCC
Q 029187            1 MSACSSTFRLPNLPNISPQNHNIVMPTTVFLSLRHSTATNPALCKLQCVGNN   52 (197)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~hs~~~n~~~~~l~cv~~~   52 (197)
                      |+.||+..|.|+-||----+|.-- |.+    -+. -..+..-|++.|+..+
T Consensus         1 ~~~~~~~~~~~~~p~~~~~~~~~~-~~~----~~~-~~~~~~~~~~~c~~~~   46 (897)
T PLN02960          1 MVSLSLFLRFPRPPNPLVHAEPRR-LGA----SRV-NLPRKIGFKITCFAAP   46 (897)
T ss_pred             CcccccccccCCCCCccccccCCC-CCc----ccc-CCccccccceeeccCC
Confidence            789999999998876221111100 111    111 1247788899998665


No 22 
>PF15059 Speriolin_C:  Speriolin C-terminus
Probab=38.96  E-value=16  Score=30.77  Aligned_cols=65  Identities=23%  Similarity=0.321  Sum_probs=47.1

Q ss_pred             hCCCCcHHHHHHHH-------hcCcCHHHHHHHHhhhcC-----------cchHHHHHHhhhHHHHhh------hc-Cch
Q 029187          133 KGVGLPDDMMEAAK-------TVGIRKMFLLRYLDLQGS-----------VWPLGFLMRYCFMLRDRM------LA-DPS  187 (197)
Q Consensus       133 rg~SLPaDL~eAae-------~GgIrsa~L~Ryl~L~as-----------p~~l~~L~rs~p~fR~RL------LA-DP~  187 (197)
                      +...+|..+.|+--       ...-+.+..+||.++.++           |.+.-+|.++|.-||+|.      .- -|.
T Consensus        28 t~sNipeKi~Q~s~~p~~~~~De~~r~~L~~ry~~im~rL~~lGY~~~~HP~lsE~lVN~yGILr~rp~l~a~~~~~yp~  107 (146)
T PF15059_consen   28 TVSNIPEKIIQASTNPLDGKVDEEKRQTLTQRYVSIMNRLQKLGYNRRVHPGLSEFLVNTYGILRERPELAASEGGSYPD  107 (146)
T ss_pred             cccccHHHHHhhccCccccccCHHHHHHHHHHHHHHHHHHHHcCCCCccCchHHHHHHHHccccccCcccccCcCcCCHH
Confidence            34456777776654       334566778899988765           667889999999888885      11 189


Q ss_pred             hhhhhhhccC
Q 029187          188 FLFKVGTEVC  197 (197)
Q Consensus       188 FL~Kl~~E~V  197 (197)
                      ||.|+.+|.|
T Consensus       108 ~L~~~v~~~v  117 (146)
T PF15059_consen  108 FLRRVVIETV  117 (146)
T ss_pred             HHHHHHHHhc
Confidence            9999998875


No 23 
>PLN03244 alpha-amylase; Provisional
Probab=37.81  E-value=37  Score=35.66  Aligned_cols=46  Identities=17%  Similarity=0.195  Sum_probs=31.3

Q ss_pred             CCcccccccCCCCCCCCCCCCcccccceeeeeecccccCCcceeeeeeccCC
Q 029187            1 MSACSSTFRLPNLPNISPQNHNIVMPTTVFLSLRHSTATNPALCKLQCVGNN   52 (197)
Q Consensus         1 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~hs~~~n~~~~~l~cv~~~   52 (197)
                      |+.|.+-.-.||-||+-.|+.+-.--+++      -++.+..-|++.|...|
T Consensus         4 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~~~   49 (872)
T PLN03244          4 LSLPTQFSCHPNASNLPFSEKNRLAINGV------NFPKKKIKLKIRCFAAE   49 (872)
T ss_pred             cccccceeecCCCCCCCcccCCccccccc------cCCccccccceeecccC
Confidence            44566555668888888887764433432      34447888999999776


No 24 
>PF12244 DUF3606:  Protein of unknown function (DUF3606);  InterPro: IPR022037  This family of proteins is found in bacteria. Proteins in this family are typically between 58 and 85 amino acids in length. There is a single completely conserved residue G that may be functionally important. 
Probab=37.73  E-value=58  Score=22.73  Aligned_cols=34  Identities=18%  Similarity=0.183  Sum_probs=29.7

Q ss_pred             HHHHHHhCCCCcHHHHHHHHhcCcCHHHHHHHHh
Q 029187          127 MKEIELKGVGLPDDMMEAAKTVGIRKMFLLRYLD  160 (197)
Q Consensus       127 LaEa~Rrg~SLPaDL~eAae~GgIrsa~L~Ryl~  160 (197)
                      ++-|.++.---+..|++|++..+-+.+.+.+||.
T Consensus        23 v~ywa~~~gvt~~~L~~AV~~vG~~~~~V~~~L~   56 (57)
T PF12244_consen   23 VRYWAKRFGVTEEQLREAVRAVGNSRAAVRAYLG   56 (57)
T ss_pred             HHHHHHHHCcCHHHHHHHHHHHCcCHHHHHHHHc
Confidence            4677787777899999999999999999999984


No 25 
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=36.97  E-value=45  Score=31.08  Aligned_cols=6  Identities=33%  Similarity=0.656  Sum_probs=2.2

Q ss_pred             CCCCCC
Q 029187           79 SSGGDG   84 (197)
Q Consensus        79 ~~~G~G   84 (197)
                      +..|-+
T Consensus       245 d~~~y~  250 (314)
T PF06524_consen  245 DDSGYG  250 (314)
T ss_pred             cccccc
Confidence            333333


No 26 
>COG3737 Uncharacterized conserved protein [Function unknown]
Probab=33.04  E-value=25  Score=29.05  Aligned_cols=36  Identities=25%  Similarity=0.226  Sum_probs=29.3

Q ss_pred             cHHHHHHHHH----------HhCCCCcHHHHHHHHhcCcCHHHHHH
Q 029187          122 KFEEVMKEIE----------LKGVGLPDDMMEAAKTVGIRKMFLLR  157 (197)
Q Consensus       122 ~~eeVLaEa~----------Rrg~SLPaDL~eAae~GgIrsa~L~R  157 (197)
                      +|+.|++++.          .+..-+|+++++|.+.-+|+.+.|.-
T Consensus        59 ~f~~vl~~a~~~EilliGTG~~~rf~p~~l~aal~~~gIsve~Mst  104 (127)
T COG3737          59 DFERVLAEAPDVEILLIGTGARLRFPPPKLRAALKAAGISVEPMST  104 (127)
T ss_pred             HHHHHHhcCCCceEEEEecCccccCCCHHHHHHHHHcCCccccccc
Confidence            4788888887          34455799999999999999988763


No 27 
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification]
Probab=29.51  E-value=53  Score=32.15  Aligned_cols=11  Identities=36%  Similarity=0.634  Sum_probs=7.7

Q ss_pred             HHHHHHHHhcC
Q 029187          139 DDMMEAAKTVG  149 (197)
Q Consensus       139 aDL~eAae~Gg  149 (197)
                      +|+++|++.++
T Consensus        46 adl~eal~~fG   56 (494)
T KOG1456|consen   46 ADLVEALSNFG   56 (494)
T ss_pred             hHHHHHHhcCC
Confidence            57777777665


No 28 
>PRK05325 hypothetical protein; Provisional
Probab=28.61  E-value=67  Score=30.78  Aligned_cols=17  Identities=18%  Similarity=0.305  Sum_probs=10.8

Q ss_pred             ccHHHHHHHHHHhCCCC
Q 029187          121 LKFEEVMKEIELKGVGL  137 (197)
Q Consensus       121 l~~eeVLaEa~Rrg~SL  137 (197)
                      +.+...|+++-+|...|
T Consensus       147 l~~~RT~r~al~Rrial  163 (401)
T PRK05325        147 LDKKRTLREALKRRIAL  163 (401)
T ss_pred             chHHHHHHHHHHHHhhc
Confidence            33566777777766654


No 29 
>COG2718 Uncharacterized conserved protein [Function unknown]
Probab=27.40  E-value=85  Score=30.53  Aligned_cols=16  Identities=44%  Similarity=0.707  Sum_probs=9.5

Q ss_pred             CCCCCCCCCCCCCCcc
Q 029187           99 DSGGGGGDGEGNDGEE  114 (197)
Q Consensus        99 ggGgg~g~g~~dd~~e  114 (197)
                      |.|++.++++++|+.+
T Consensus       100 g~g~~ag~~egED~F~  115 (423)
T COG2718         100 GKGQAAGDGEGEDEFV  115 (423)
T ss_pred             CCCCccCCCCCcchhh
Confidence            3445666677777643


No 30 
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification]
Probab=26.01  E-value=76  Score=28.51  Aligned_cols=10  Identities=20%  Similarity=0.448  Sum_probs=4.9

Q ss_pred             cHHHHHHHHH
Q 029187          122 KFEEVMKEIE  131 (197)
Q Consensus       122 ~~eeVLaEa~  131 (197)
                      ++..-|+||+
T Consensus       131 DLKDHmReaG  140 (241)
T KOG0105|consen  131 DLKDHMREAG  140 (241)
T ss_pred             HHHHHHHhhC
Confidence            3445555544


No 31 
>COG4174 ABC-type uncharacterized transport system, permease component [General function prediction only]
Probab=25.86  E-value=1.3e+02  Score=28.42  Aligned_cols=19  Identities=32%  Similarity=0.279  Sum_probs=11.9

Q ss_pred             HhcCcCHHHHHHHHhhhcC
Q 029187          146 KTVGIRKMFLLRYLDLQGS  164 (197)
Q Consensus       146 e~GgIrsa~L~Ryl~L~as  164 (197)
                      +.-++.+-.+.||+.|-.+
T Consensus        90 ~~~GFDKp~~eR~~~Ml~~  108 (364)
T COG4174          90 KQYGFDKPPLERYFLMLWD  108 (364)
T ss_pred             HHhCCCCCHHHHHHHHHHH
Confidence            4456666677777766443


No 32 
>TIGR02877 spore_yhbH sporulation protein YhbH. This protein family, typified by YhbH in Bacillus subtilis, is found in nearly every endospore-forming bacterium and in no other genome (but note that the trusted cutoff score is set high to exclude a single high-scoring sequence from Nitrosococcus oceani ATCC 19707, which is classified in the Gammaproteobacteria). The gene in Bacillus subtilis was shown to be in the regulon of the sporulation sigma factor, sigma-E, and its mutation was shown to create a sporulation defect.
Probab=25.68  E-value=91  Score=29.76  Aligned_cols=14  Identities=7%  Similarity=-0.166  Sum_probs=8.0

Q ss_pred             HHHHHHHHHHhCCC
Q 029187          123 FEEVMKEIELKGVG  136 (197)
Q Consensus       123 ~eeVLaEa~Rrg~S  136 (197)
                      +...|+++-+|...
T Consensus       161 ~~RT~r~al~Rria  174 (371)
T TIGR02877       161 KKRTVIEALKRNQL  174 (371)
T ss_pred             HHHHHHHHHHHHhh
Confidence            45566666665544


No 33 
>PF04360 Serglycin:  Serglycin ;  InterPro: IPR007455 Serglycin is the most prevalent proteoglycan produced in haemopoietic cells. Serglycin is a proteinase resistant secretory granule proteoglycan [].
Probab=24.58  E-value=51  Score=27.94  Aligned_cols=20  Identities=25%  Similarity=0.350  Sum_probs=13.0

Q ss_pred             CCCcccccceeeeeeccccc
Q 029187           19 QNHNIVMPTTVFLSLRHSTA   38 (197)
Q Consensus        19 ~~~~~~~~~~~~~~l~hs~~   38 (197)
                      ++..||+-.|+.|+|-+|..
T Consensus         5 ~~~rl~LaLalil~l~ssvq   24 (150)
T PF04360_consen    5 QCSRLVLALALILVLDSSVQ   24 (150)
T ss_pred             ccchhHHHHHHHHHhccccc
Confidence            44556666677777777665


No 34 
>COG3423 Nlp Predicted transcriptional regulator [Transcription]
Probab=21.97  E-value=66  Score=24.88  Aligned_cols=46  Identities=30%  Similarity=0.302  Sum_probs=26.5

Q ss_pred             cHHHHHHHHhcCcCHHHHHHHHhhhcCcchHHHHHHhhhHHHHhhhcC
Q 029187          138 PDDMMEAAKTVGIRKMFLLRYLDLQGSVWPLGFLMRYCFMLRDRMLAD  185 (197)
Q Consensus       138 PaDL~eAae~GgIrsa~L~Ryl~L~asp~~l~~L~rs~p~fR~RLLAD  185 (197)
                      |+|+.+|+++-+.+=..|++=--|..+-+ -..|.|.+|- -+|++||
T Consensus        10 ~adI~A~Lkk~G~Sl~~LS~~agls~~tL-~n~L~rp~pk-gEriIA~   55 (82)
T COG3423          10 PADIIAALKKKGTSLAALSREAGLSSSTL-ANALDRPWPK-GERIIAD   55 (82)
T ss_pred             HHHHHHHHHHccccHHHHHHHcCCCHHHH-HHHHcCCCch-HHHHHHH
Confidence            67788888877777666665544443332 3444444441 2566665


No 35 
>TIGR00625 tfb2 Transcription factor tfb2. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.81  E-value=1.5e+02  Score=28.88  Aligned_cols=66  Identities=15%  Similarity=0.184  Sum_probs=48.4

Q ss_pred             HHHHHHHHHhCCCCc---------HHHHHHHHhcCcCHHHHHHHHhhhcCcchHHH------------HHHhhhHHHHhh
Q 029187          124 EEVMKEIELKGVGLP---------DDMMEAAKTVGIRKMFLLRYLDLQGSVWPLGF------------LMRYCFMLRDRM  182 (197)
Q Consensus       124 eeVLaEa~Rrg~SLP---------aDL~eAae~GgIrsa~L~Ryl~L~asp~~l~~------------L~rs~p~fR~RL  182 (197)
                      -++|+.-.+-...+|         .-+++|++.| |+..++.+||+-.++|- ++-            =+|.|..=|+|+
T Consensus       312 ~~il~lF~~~~~r~pnlvvg~iTr~Sv~~A~~~G-ITa~qIi~fl~~~ahp~-~~~~~~~~lP~tv~dQi~lWe~e~~R~  389 (448)
T TIGR00625       312 IALIALFSELLARFPNMVVGQITRESIRRALANG-ITAQQIIHYLRTHAHPQ-MRKEQTPVLPPTIVDQIRLWELERDRL  389 (448)
T ss_pred             HHHHHHHHHHHhcCCceEEEEecHHHHHHHHHcC-CCHHHHHHHHHhcCChh-hhccCCCCCChHHHHHHHHHHHHhcce
Confidence            356766666666665         5567777777 99999999999999876 321            123344669999


Q ss_pred             hcCchhhhh
Q 029187          183 LADPSFLFK  191 (197)
Q Consensus       183 LADP~FL~K  191 (197)
                      -..|.||||
T Consensus       390 ~~~~~~l~~  398 (448)
T TIGR00625       390 RFTEGVLYN  398 (448)
T ss_pred             Eeecceeee
Confidence            999999987


No 36 
>PRK08558 adenine phosphoribosyltransferase; Provisional
Probab=21.25  E-value=2.6e+02  Score=24.34  Aligned_cols=38  Identities=16%  Similarity=0.174  Sum_probs=29.4

Q ss_pred             HHHHHHHHHHhCCCCcHHHHHHHHhcCcCHHHHHHHHhhhcCc
Q 029187          123 FEEVMKEIELKGVGLPDDMMEAAKTVGIRKMFLLRYLDLQGSV  165 (197)
Q Consensus       123 ~eeVLaEa~Rrg~SLPaDL~eAae~GgIrsa~L~Ryl~L~asp  165 (197)
                      .-++|+.+.++.     ...|=.+.-+|+..+|.||.....-|
T Consensus        13 ~v~~lr~lk~~~-----ty~el~~~~g~p~~~l~RYv~g~~~P   50 (238)
T PRK08558         13 AVRVLRSLKKTY-----TYEELSSITGLPESVLNRYVNGHVLP   50 (238)
T ss_pred             HHHHHHHHhccc-----CHHHHHHHHCCCHHHHHHHHcCCcCC
Confidence            345677666654     56677788899999999999988877


No 37 
>PF10415 FumaraseC_C:  Fumarase C C-terminus;  InterPro: IPR018951  Fumarase C catalyses the stereo-specific interconversion of fumarate to L-malate as part of the Krebs cycle. The full-length protein forms a tetramer with visible globular shape. FumaraseC_C is the C-terminal 65 residues referred to as domain 3. The core of the molecule consists of a bundle of 20 alpha-helices from the five-helix bundle of domain 2. The projections from the core of the tetramer are generated from domains 1 and 3 of each subunit []. This entry does not appear to be part of either the active site or the activation site but is helical in structure forming a little bundle. ; GO: 0016829 lyase activity, 0006099 tricarboxylic acid cycle; PDB: 3RRP_A 3OCE_D 3OCF_D 3E04_B 3GTD_A 3R6V_F 3R6Q_F 1J3U_B 1FUR_A 1YFE_A ....
Probab=20.60  E-value=1.2e+02  Score=21.02  Aligned_cols=36  Identities=19%  Similarity=0.137  Sum_probs=26.5

Q ss_pred             HHHHHHHHHhCCCCcHHHHHHHHhcCcCHHHHHHHHhhh
Q 029187          124 EEVMKEIELKGVGLPDDMMEAAKTVGIRKMFLLRYLDLQ  162 (197)
Q Consensus       124 eeVLaEa~Rrg~SLPaDL~eAae~GgIrsa~L~Ryl~L~  162 (197)
                      -+|-++|.+++.++-.   .+++.|.++.+++.+.|+.+
T Consensus        15 a~iAk~A~~~g~svre---~v~~~g~lt~ee~d~ll~p~   50 (55)
T PF10415_consen   15 AEIAKEALAEGRSVRE---VVLEEGLLTEEELDELLDPE   50 (55)
T ss_dssp             HHHHHHHHHHT--HHH---HHHHTTSS-HHHHHHHTSHH
T ss_pred             HHHHHHHHHcCCCHHH---HHHHcCCCCHHHHHHHcCHH
Confidence            5688899999998863   35578889999999998765


No 38 
>smart00845 GatB_Yqey GatB domain. This domain is found in GatB and proteins related to bacterial Yqey. It is about 140 amino acid residues long. This domain is found at the C terminus of GatB which transamidates Glu-tRNA to Gln-tRNA. The function of this domain is uncertain. It does however suggest that Yqey and its relatives have a role in tRNA metabolism.
Probab=20.51  E-value=2.2e+02  Score=22.58  Aligned_cols=68  Identities=24%  Similarity=0.347  Sum_probs=40.8

Q ss_pred             HHHHHHHHHHhCCCCcHHHHHHHHhcCcCHH-HHHHHHh--hhcC---------------cchHHHHHHhhhHHHHhhhc
Q 029187          123 FEEVMKEIELKGVGLPDDMMEAAKTVGIRKM-FLLRYLD--LQGS---------------VWPLGFLMRYCFMLRDRMLA  184 (197)
Q Consensus       123 ~eeVLaEa~Rrg~SLPaDL~eAae~GgIrsa-~L~Ryl~--L~as---------------p~~l~~L~rs~p~fR~RLLA  184 (197)
                      ..+|+++...... =|.++.+...-..|+.+ .+....+  ++..               -++++.+|+   ..++|  |
T Consensus        61 ak~vl~~~~~~~~-~~~~ii~~~~l~~isd~~el~~~v~~vi~~~~~~v~~~~~g~~k~~~~l~G~vMk---~~~G~--a  134 (147)
T smart00845       61 AKEVLEELLESGK-SPEEIVEEKGLKQISDEGELEAIVDEVIAENPKAVEDYRAGKKKALGFLVGQVMK---ATRGK--A  134 (147)
T ss_pred             HHHHHHHHHHcCC-CHHHHHHHcCCccCCCHHHHHHHHHHHHHHCHHHHHHHHCCHHHHHHHHHHHHHH---HhcCC--C
Confidence            3567777666543 37777777666667653 4544432  2222               144666666   56777  7


Q ss_pred             Cchhhhhhhhcc
Q 029187          185 DPSFLFKVGTEV  196 (197)
Q Consensus       185 DP~FL~Kl~~E~  196 (197)
                      ||.-+.++..|.
T Consensus       135 d~~~v~~~l~~~  146 (147)
T smart00845      135 DPKLVNELLKEK  146 (147)
T ss_pred             CHHHHHHHHHHh
Confidence            888877776654


No 39 
>PF05225 HTH_psq:  helix-turn-helix, Psq domain;  InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster []. In pipsqueak this domain binds to GAGA sequence []. The pipsqueak family, which includes proteins from fungi, sea urchins, nematodes, insects, and vertebrates appear to be proteins essential for sequence-specific targeting of a polycomb group protein complex [].; GO: 0003677 DNA binding; PDB: 2COB_A.
Probab=20.14  E-value=1.1e+02  Score=20.13  Aligned_cols=22  Identities=32%  Similarity=0.341  Sum_probs=17.0

Q ss_pred             HHHHHHhcCcCHHHHHHHHhhh
Q 029187          141 MMEAAKTVGIRKMFLLRYLDLQ  162 (197)
Q Consensus       141 L~eAae~GgIrsa~L~Ryl~L~  162 (197)
                      +++|++..+|+...|.+++.-.
T Consensus        19 ~r~AA~~ygVp~sTL~~r~~g~   40 (45)
T PF05225_consen   19 IRKAAKKYGVPRSTLRRRLRGK   40 (45)
T ss_dssp             HHHHHHHHT--HHHHHHHHHHT
T ss_pred             HHHHHHHHCcCHHHHHHHHcCC
Confidence            6899999999999999987643


Done!