Citrus Sinensis ID: 029217

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTLQRKRARIAEKKQRIAKAKAEAAEYQKLLATRLKEQRERRSESLAKKRSRLSAASKPSIAA
ccccccccccccccccccccEEEEEccccccccccccccccCEECccccccccccccEEEEEEEEcccccccccccccccccccccccHHHHHHcccccccccEEEEEEcEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
*GGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDLP****************SKIRKLFNLSKEDDVRKYVNTYRRTF*************IQRLVTPLTLQRKRA******************YQKL*********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGGCDKQGFPMKQGVLTPGRVRLLLHRGTPCFRGYGRRDGERRRKSVRGCIVSPDLSVLNLVIVKKGEHDLPGLTDTEKPRMRGPKRASKIRKLFNLSKEDDVRKYVNTYRRTFTTKSGKKVSKAPKIQRLVTPLTxxxxxxxxxxxxxxxxxxxxxxxxxxxxLATRLKEQRERRSESLAKKRSRLSAASKPSIAA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
40S ribosomal protein S6 (Fragment) May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.probableP29345
40S ribosomal protein S6 May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.probableQ9M3V8
40S ribosomal protein S6-1 May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.probableO48549

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U5C, chain G
Confidence level:very confident
Coverage over the Query: 1-170
View the alignment between query and template
View the model in PyMOL