BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029233
         (197 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4DCF|A Chain A, Structure Of Mtx-Ii From Bothrops Brazili
 pdb|4DCF|B Chain B, Structure Of Mtx-Ii From Bothrops Brazili
 pdb|4DCF|C Chain C, Structure Of Mtx-Ii From Bothrops Brazili
 pdb|4DCF|D Chain D, Structure Of Mtx-Ii From Bothrops Brazili
          Length = 122

 Score = 26.9 bits (58), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 117 YHVSWQSNFGFCCELDDECAQELTGVPGVLSVQPDENFGSENKDYGGNNLQ 167
           Y  SW+     C E ++ C +EL      +++   EN  + NK Y  N+L+
Sbjct: 64  YSYSWKDKTIVCGE-NNSCLKELCECDKAVAICLRENLDTYNKKYRNNHLK 113


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.134    0.422 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,372,843
Number of Sequences: 62578
Number of extensions: 261933
Number of successful extensions: 566
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 565
Number of HSP's gapped (non-prelim): 6
length of query: 197
length of database: 14,973,337
effective HSP length: 94
effective length of query: 103
effective length of database: 9,091,005
effective search space: 936373515
effective search space used: 936373515
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)