BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 029233
(197 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4DCF|A Chain A, Structure Of Mtx-Ii From Bothrops Brazili
pdb|4DCF|B Chain B, Structure Of Mtx-Ii From Bothrops Brazili
pdb|4DCF|C Chain C, Structure Of Mtx-Ii From Bothrops Brazili
pdb|4DCF|D Chain D, Structure Of Mtx-Ii From Bothrops Brazili
Length = 122
Score = 26.9 bits (58), Expect = 7.2, Method: Compositional matrix adjust.
Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 1/51 (1%)
Query: 117 YHVSWQSNFGFCCELDDECAQELTGVPGVLSVQPDENFGSENKDYGGNNLQ 167
Y SW+ C E ++ C +EL +++ EN + NK Y N+L+
Sbjct: 64 YSYSWKDKTIVCGE-NNSCLKELCECDKAVAICLRENLDTYNKKYRNNHLK 113
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.134 0.422
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,372,843
Number of Sequences: 62578
Number of extensions: 261933
Number of successful extensions: 566
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 565
Number of HSP's gapped (non-prelim): 6
length of query: 197
length of database: 14,973,337
effective HSP length: 94
effective length of query: 103
effective length of database: 9,091,005
effective search space: 936373515
effective search space used: 936373515
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 49 (23.5 bits)