Query         029257
Match_columns 196
No_of_seqs    164 out of 685
Neff          3.9 
Searched_HMMs 46136
Date          Fri Mar 29 10:02:07 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/029257.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/029257hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03106 WRKY:  WRKY DNA -bindi 100.0 1.1E-33 2.3E-38  200.0   1.9   59  101-159     1-59  (60)
  2 smart00774 WRKY DNA binding do 100.0   2E-32 4.3E-37  193.8   5.1   58  101-158     1-59  (59)
  3 PF04500 FLYWCH:  FLYWCH zinc f  92.8   0.036 7.8E-07   36.7   0.3   49  100-158    11-62  (62)
  4 PF03101 FAR1:  FAR1 DNA-bindin  85.2    0.95 2.1E-05   32.5   2.9   30  130-160    60-89  (91)
  5 PLN03097 FHY3 Protein FAR-RED   40.5      32 0.00069   35.8   3.8   34  127-161   156-189 (846)
  6 KOG0673 Thymidylate synthase [  24.9      27 0.00058   31.9   0.3   12  102-113   114-125 (293)
  7 PF03859 CG-1:  CG-1 domain;  I  23.2      82  0.0018   25.6   2.7   10  100-109    50-59  (118)
  8 cd07691 Ig_CD3_gamma_delta Imm  16.1 1.6E+02  0.0035   21.7   2.8   27  103-130    17-53  (69)
  9 PF03615 GCM:  GCM motif protei  13.0 1.7E+02  0.0037   24.5   2.4   17  148-164   118-134 (143)
 10 COG4283 Uncharacterized conser  11.2      96  0.0021   26.7   0.4   14   99-112    74-87  (170)

No 1  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.97  E-value=1.1e-33  Score=199.98  Aligned_cols=59  Identities=56%  Similarity=1.202  Sum_probs=52.5

Q ss_pred             CCCcchhhhcCCcccCCCCCCCcccccCCCCCCcceeeeecCCCCcEEEEEEeeecCCC
Q 029257          101 MDDGFKWRKYGKKSVKNSPNPRNYYKCSTGGCQVKKRVERDREDSSYVITTYEGTHNHE  159 (196)
Q Consensus       101 ~dDGy~WRKYGQK~Ikgs~~pRsYYrCs~~gC~akKqVqr~~~D~~~~~ttY~G~HnH~  159 (196)
                      ++|||+|||||||.|+|+++||+||||++.+|+|+|+|||+.+|+.+|+|||+|+|||+
T Consensus         1 ~~Dgy~WRKYGqK~i~g~~~pRsYYrCt~~~C~akK~Vqr~~~d~~~~~vtY~G~H~h~   59 (60)
T PF03106_consen    1 LDDGYRWRKYGQKNIKGSPYPRSYYRCTHPGCPAKKQVQRSADDPNIVIVTYEGEHNHP   59 (60)
T ss_dssp             --SSS-EEEEEEEEETTTTCEEEEEEEECTTEEEEEEEEEETTCCCEEEEEEES--SS-
T ss_pred             CCCCCchhhccCcccCCCceeeEeeeccccChhheeeEEEecCCCCEEEEEEeeeeCCC
Confidence            58999999999999999999999999999999999999999999999999999999996


No 2  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.97  E-value=2e-32  Score=193.79  Aligned_cols=58  Identities=55%  Similarity=1.142  Sum_probs=56.5

Q ss_pred             CCCcchhhhcCCcccCCCCCCCcccccCC-CCCCcceeeeecCCCCcEEEEEEeeecCC
Q 029257          101 MDDGFKWRKYGKKSVKNSPNPRNYYKCST-GGCQVKKRVERDREDSSYVITTYEGTHNH  158 (196)
Q Consensus       101 ~dDGy~WRKYGQK~Ikgs~~pRsYYrCs~-~gC~akKqVqr~~~D~~~~~ttY~G~HnH  158 (196)
                      ++|||+|||||||.|+|+++||+||||++ ++|+|+|+|||+++|+.+++|||+|+|||
T Consensus         1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~~~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774        1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTYSQGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCcccccccCcEecCCCcCcceEEeccccCCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            47999999999999999999999999999 99999999999999999999999999998


No 3  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=92.75  E-value=0.036  Score=36.72  Aligned_cols=49  Identities=24%  Similarity=0.673  Sum_probs=24.8

Q ss_pred             cCCCcchhhhcCCcccCCCCCCCcccccCCC---CCCcceeeeecCCCCcEEEEEEeeecCC
Q 029257          100 VMDDGFKWRKYGKKSVKNSPNPRNYYKCSTG---GCQVKKRVERDREDSSYVITTYEGTHNH  158 (196)
Q Consensus       100 ~~dDGy~WRKYGQK~Ikgs~~pRsYYrCs~~---gC~akKqVqr~~~D~~~~~ttY~G~HnH  158 (196)
                      ++-|||.-++....      ..+.|++|+..   +|+|+-.+.  .++..  ++...++|||
T Consensus        11 L~~~Gy~y~~~~~~------~~~~~WrC~~~~~~~C~a~~~~~--~~~~~--~~~~~~~HnH   62 (62)
T PF04500_consen   11 LVYDGYRYYFNKRN------DGKTYWRCSRRRSHGCRARLITD--AGDGR--VVRTNGEHNH   62 (62)
T ss_dssp             EEETTEEEEEEEE-------SS-EEEEEGGGTTS----EEEEE----TTE--EEE-S---SS
T ss_pred             EEECCeEEECcCCC------CCcEEEEeCCCCCCCCeEEEEEE--CCCCE--EEECCCccCC
Confidence            45688877765544      45689999963   899987777  33333  3344589998


No 4  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=85.22  E-value=0.95  Score=32.48  Aligned_cols=30  Identities=30%  Similarity=0.639  Sum_probs=26.1

Q ss_pred             CCCCcceeeeecCCCCcEEEEEEeeecCCCC
Q 029257          130 GGCQVKKRVERDREDSSYVITTYEGTHNHES  160 (196)
Q Consensus       130 ~gC~akKqVqr~~~D~~~~~ttY~G~HnH~~  160 (196)
                      -||+|+=.|-+.. +...+++.+..+|||+.
T Consensus        60 tgC~a~i~v~~~~-~~~w~v~~~~~~HNH~L   89 (91)
T PF03101_consen   60 TGCKARINVKRRK-DGKWRVTSFVLEHNHPL   89 (91)
T ss_pred             cCCCEEEEEEEcc-CCEEEEEECcCCcCCCC
Confidence            5999999998866 77888899999999975


No 5  
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=40.50  E-value=32  Score=35.78  Aligned_cols=34  Identities=32%  Similarity=0.662  Sum_probs=28.9

Q ss_pred             cCCCCCCcceeeeecCCCCcEEEEEEeeecCCCCC
Q 029257          127 CSTGGCQVKKRVERDREDSSYVITTYEGTHNHESP  161 (196)
Q Consensus       127 Cs~~gC~akKqVqr~~~D~~~~~ttY~G~HnH~~p  161 (196)
                      |+-.||+|+=.|.+. .+...+++-+..+|||+.-
T Consensus       156 ~tRtGC~A~m~Vk~~-~~gkW~V~~fv~eHNH~L~  189 (846)
T PLN03097        156 CAKTDCKASMHVKRR-PDGKWVIHSFVKEHNHELL  189 (846)
T ss_pred             ccCCCCceEEEEEEc-CCCeEEEEEEecCCCCCCC
Confidence            777899999999884 4567889999999999884


No 6  
>KOG0673 consensus Thymidylate synthase [Nucleotide transport and metabolism]
Probab=24.86  E-value=27  Score=31.94  Aligned_cols=12  Identities=42%  Similarity=1.190  Sum_probs=10.0

Q ss_pred             CCcchhhhcCCc
Q 029257          102 DDGFKWRKYGKK  113 (196)
Q Consensus       102 dDGy~WRKYGQK  113 (196)
                      -=||+||-+|-|
T Consensus       114 vyGfqWrHfgA~  125 (293)
T KOG0673|consen  114 VYGFQWRHFGAR  125 (293)
T ss_pred             ccceeeeecCcc
Confidence            358999999977


No 7  
>PF03859 CG-1:  CG-1 domain;  InterPro: IPR005559  CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein []. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin-binding domain and ankyrins [].; GO: 0005516 calmodulin binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=23.18  E-value=82  Score=25.56  Aligned_cols=10  Identities=50%  Similarity=1.099  Sum_probs=8.0

Q ss_pred             cCCCcchhhh
Q 029257          100 VMDDGFKWRK  109 (196)
Q Consensus       100 ~~dDGy~WRK  109 (196)
                      .-.|||.|||
T Consensus        50 fRkDG~~WrK   59 (118)
T PF03859_consen   50 FRKDGHNWRK   59 (118)
T ss_pred             hhcccceeEE
Confidence            3569999995


No 8  
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=16.13  E-value=1.6e+02  Score=21.73  Aligned_cols=27  Identities=33%  Similarity=0.811  Sum_probs=18.7

Q ss_pred             CcchhhhcCCcccCC--------C--CCCCcccccCCC
Q 029257          103 DGFKWRKYGKKSVKN--------S--PNPRNYYKCSTG  130 (196)
Q Consensus       103 DGy~WRKYGQK~Ikg--------s--~~pRsYYrCs~~  130 (196)
                      .-+.|-| |...+.-        +  .-||.=|+|.-.
T Consensus        17 tsi~W~k-G~~~~~~~~~tlnLGs~~~DPRG~Y~C~~s   53 (69)
T cd07691          17 TNITWKK-GKEILEVSNTLLDLGSRINDPRGTYSCKES   53 (69)
T ss_pred             CcEEEec-CcccccccccEEeccCcccCCCcceEecCc
Confidence            4478888 7644432        2  689999999643


No 9  
>PF03615 GCM:  GCM motif protein;  InterPro: IPR003902  GCM transcription factors are a family of proteins which contain a GCM motif. The GCM motif is a domain that has been identified in proteins belonging to a family of transcriptional regulators involved in fundamental developmental processes which comprise Drosophila melanogaster GCM and its mammalian homologs [, , , ]. IN GCM transcription factors the N-terminal moiety contains a DNA-binding domain of 150 residues. Sequence conservation is highest in this GCM domain. In contrast, the C-terminal moiety contains one or two transactivating regions and is only poorly conserved.  The GCM motif has been shown to be a DNA binding domain that recognises preferentially the nonpalindromic octamer 5'-ATGCGGGT-3' [, , ]. The GCM motif contains many conserved basic amino acid residues, seven cysteine residues, and four histidine residues []. The conserved cysteines are involved in shaping the overall conformation of the domain, in the process of DNA binding and in the redox regulation of DNA binding []. The GCM domain as a new class of Zn-containing DNA-binding domain with no similarity to any other DNA-binding domain []. The GCM domain consists of a large and a small domain tethered together by one of the two Zn ions present in the structure. The large and the small domains comprise five- and three-stranded beta-sheets, respectively, with three small helical segments packed against the same side of the two beta-sheets. The GCM domain exercises a novel mode of sequence-specific DNA recognition, where the five-stranded beta-pleated sheet inserts into the major groove of the DNA. Residues protruding from the edge strand of the beta-pleated sheet and the following loop and strand contact the bases and backbone of both DNA strands, providing specificity for its DNA target site. ; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1ODH_A.
Probab=12.95  E-value=1.7e+02  Score=24.50  Aligned_cols=17  Identities=24%  Similarity=0.471  Sum_probs=4.8

Q ss_pred             EEEEEeeecCCCCCccc
Q 029257          148 VITTYEGTHNHESPCVV  164 (196)
Q Consensus       148 ~~ttY~G~HnH~~p~~~  164 (196)
                      +...=+|.|.|+.|...
T Consensus       118 IfFQaKG~HDHpRPe~K  134 (143)
T PF03615_consen  118 IFFQAKGVHDHPRPEAK  134 (143)
T ss_dssp             EEEEEE----S-----H
T ss_pred             EEEEcccccCCCCCCcc
Confidence            34466999999999754


No 10 
>COG4283 Uncharacterized conserved protein [Function unknown]
Probab=11.19  E-value=96  Score=26.67  Aligned_cols=14  Identities=29%  Similarity=0.750  Sum_probs=11.4

Q ss_pred             ccCCCcchhhhcCC
Q 029257           99 EVMDDGFKWRKYGK  112 (196)
Q Consensus        99 ~~~dDGy~WRKYGQ  112 (196)
                      .++.+||.|+.||.
T Consensus        74 f~Ps~~ykWn~~ge   87 (170)
T COG4283          74 FTPSPGYKWNNLGE   87 (170)
T ss_pred             CCCCCCCcccccHH
Confidence            35789999999983


Done!