BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 029288
         (196 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4HVT|A Chain A, Structure Of A Post-Proline Cleaving Enzyme From
           Rickettsia Typhi
          Length = 711

 Score = 26.6 bits (57), Expect = 9.7,   Method: Composition-based stats.
 Identities = 24/70 (34%), Positives = 30/70 (42%), Gaps = 14/70 (20%)

Query: 136 ASEICGFITVLSGTIILHA-----------TREHEQTTAPVGTVTWY---VSGDSLKGAE 181
           A+E+  FI+     + L             T E+EQ T PV     Y   + G S    E
Sbjct: 348 ANEVFNFISTTKDRVFLATYDNVVAKVVTFTLENEQWTKPVVLKLPYQNAIFGMSSYEEE 407

Query: 182 EEHLITIHNS 191
           EE LITI NS
Sbjct: 408 EEALITIENS 417


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.137    0.411 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 4,957,145
Number of Sequences: 62578
Number of extensions: 172134
Number of successful extensions: 424
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 423
Number of HSP's gapped (non-prelim): 2
length of query: 196
length of database: 14,973,337
effective HSP length: 94
effective length of query: 102
effective length of database: 9,091,005
effective search space: 927282510
effective search space used: 927282510
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 49 (23.5 bits)