Citrus Sinensis ID: 029307


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MASSSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVSRCNWRTFDST
ccccccccccccccHHHHHHHHHHHHcccccccEEEEEcccccccccHHHHHHHHcccccccHHHHHHHHHHcccHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHccccccccccccccccccccccccccccccccccccccc
************PSVDL*****************LILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVSRCNWRTFD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSAANLEDVPSVDLMTELLRRMKCASKPDKRLILVGPPGSGKGTQSPIIKDEYCLCHLATGDMLRAAVAAKTPLGIKAKEAMDKGELVSDDLVVGIIDEAMKKPSCQKGFILDGFPRTEVQAQKLDEMLEKQGKKVDKVLNFAIDDAVLEERITGRWIHPSSGRTYHTKFAPPKVPGVDDVSRCNWRTFDST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Adenylate kinase B This small ubiquitous enzyme is essential for maintenance and cell growth.confidentQ08480
Adenylate kinase 2 This small ubiquitous enzyme is essential for maintenance and cell growth.probableQ9FK35
Adenylate kinase 2, mitochondrial Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Plays a key role in hematopoiesis.probableP54819

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.3Adenylate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TLX, chain A
Confidence level:very confident
Coverage over the Query: 12-189
View the alignment between query and template
View the model in PyMOL