BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 029340
(195 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1LU4|A Chain A, 1.1 Angstrom Resolution Crystal Structure Of A Secreted
Mycobacterium Tuberculosis Disulfide Oxidoreductase
Homologous To E. Coli Dsbe: Implications For Functions
Length = 136
Score = 26.6 bits (57), Expect = 8.2, Method: Compositional matrix adjust.
Identities = 15/41 (36%), Positives = 20/41 (48%)
Query: 148 FNATAGASSCFFLSKLIGRPLVSWFWPEKLRFFQAEVLLIS 188
F AT + + F + L G+P V WFW F AE +S
Sbjct: 7 FTATTLSGAPFDGASLQGKPAVLWFWTPWCPFCNAEAPSLS 47
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.327 0.141 0.442
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,090,076
Number of Sequences: 62578
Number of extensions: 170285
Number of successful extensions: 337
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 336
Number of HSP's gapped (non-prelim): 1
length of query: 195
length of database: 14,973,337
effective HSP length: 94
effective length of query: 101
effective length of database: 9,091,005
effective search space: 918191505
effective search space used: 918191505
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 49 (23.5 bits)